(data stored in ACNUC7421 zone)

EMBL: CP001053.PE136

CP001053.PE136       Location/Qualifiers
FT   CDS_pept        169451..170692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4127"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bxe:Bxe_B0554 allantoate amidohydrolase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18511"
FT                   /db_xref="GOA:B2TEJ0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ0"
FT                   /protein_id="ACD18511.1"
FT                   /translation="MVRIDPDRLLSDLKQLRSFGATGPGVVRLALSPVDLASREWLAGR
FT                   MTEAGLEAAIDGVGTVFGRSRKSGPALVIGSHTDTQPTGGWLDGAMGVIYGLEIARALA
FT                   ENEATRHLAVDVASWIDEEGTFSGLLGSRSFVGENVDETIRDATNRQGQRLADVLATAG
FT                   LAGRPRARFEPGRQVAYLEPHIEQGGRLEAAGKSIGVVTTIVGLRELRLRFTGQRNHAG
FT                   TTPMAIRRDAGAALVAFIPQMNEAFAQLADADTVWTVGRIDLDPGSLSVVPGAAQMYLQ
FT                   FRDANAARLQAMEDRLAQLVRDFNARSSISVELTTIDEPMQPVTMHTVLADHLARAAEA
FT                   VAPGQWIRMPSGAAHDAQVIARCMPACMMFVPSIGGVSHDFIEDTAEAHIVLGCQVAAT
FT                   AAAAMLEEQWAKRS"
     gtggtgagga tcgatccgga ccggttgctg agtgatctca agcaactacg cagtttcggc        60
     gccaccggcc caggcgtcgt tcggctggcg ctttcgccgg tggatctggc gtcgcgcgaa       120
     tggctcgccg gacgcatgac ggaggcggga ctcgaggccg cgatcgacgg cgtggggacc       180
     gtgttcggac gctcgcgcaa aagcggcccc gcgctcgtga tcggctcgca taccgacacg       240
     cagccgaccg gcggctggct cgacggcgca atgggtgtga tctacgggct ggagattgca       300
     cgcgcgctcg cggaaaacga ggcgacgcgt cacctcgcgg tggacgtcgc atcgtggatc       360
     gatgaagaag gcacgttttc cggcctgctc ggcagccgca gtttcgtggg cgagaacgtc       420
     gacgagacga ttcgcgacgc gacgaatcgg caaggccagc gtctcgcaga cgtgctcgcc       480
     accgcgggtc tggccggacg gccgcgtgcg cgcttcgagc cgggccggca ggtcgcctat       540
     ctcgaaccgc atatcgagca gggcggccgg ctggaagcgg ccggcaaatc catcggggtc       600
     gtcaccacga tcgtggggct gcgtgaattg cggctgcgct tcacagggca gcgcaatcat       660
     gcgggcacga cgcccatggc gatccgccgt gacgccggcg ccgcgttggt cgcctttatc       720
     ccgcagatga acgaagcgtt cgcgcaactt gcggatgccg acaccgtctg gacggtgggc       780
     cgcatcgacc tcgaccccgg ctcgttgagc gtcgtgcctg gcgcagcgca gatgtatttg       840
     caattccgcg acgcgaacgc cgcgcgtttg caggcgatgg aagacaggct cgcccagctg       900
     gtacgggact tcaacgcgcg cagttcgatc agcgtcgagc tgaccaccat cgacgagccg       960
     atgcaacccg tgaccatgca cacggtgctc gcagaccatc tcgcccgcgc cgccgaagcg      1020
     gtggcgcccg gccaatggat ccgcatgccg agcggcgccg cgcacgacgc gcaggtcatc      1080
     gcgcgctgca tgccggcttg catgatgttc gtgccgagca ttggcggcgt gagtcacgat      1140
     ttcatcgagg atacggccga ggcgcacatc gttctcggtt gccaggtcgc ggccacggct      1200
     gcggcggcga tgctggagga gcaatgggcg aaacggtcgt aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page