(data stored in ACNUC7421 zone)

EMBL: CP001053.PE138

CP001053.PE138       Location/Qualifiers
FT   CDS_pept        complement(171643..171948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18513"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ2"
FT                   /protein_id="ACD18513.1"
FT                   /translation="MRMLLNIRIPHEPFNTMVREGTVGQVIGKILEEIKPEAVYFTEQS
FT                   GARGAVVVVDIDNASAIPALAEPWFLKFNADCELRIAMLPEDLQKAGLENLGSKWK"
     atgcgcatgc ttctcaacat acgaatcccg cacgaaccgt tcaacaccat ggtgcgcgag        60
     ggcaccgtcg ggcaagtgat cggcaaaata ctggaagaaa taaaaccgga agccgtctac       120
     ttcaccgagc agagtggagc gcgcggagca gtcgtcgtgg tggatatcga caacgcgtcg       180
     gcgattcccg cacttgcgga gccgtggttt ctgaaattca acgccgactg cgaattgcgc       240
     atcgcgatgc tgccggaaga tctgcagaaa gccggactgg agaacctcgg ctcgaaatgg       300
     aaatag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page