(data stored in ACNUC7421 zone)

EMBL: CP001053.PE139

CP001053.PE139       Location/Qualifiers
FT   CDS_pept        complement(172109..172741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4130"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: methylguanine DNA
FT                   methyltransferase ribonuclease domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: bxe:Bxe_B0556
FT                   methylated-DNA-(protein)-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18514"
FT                   /db_xref="GOA:B2TEJ3"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ3"
FT                   /protein_id="ACD18514.1"
FT                   /translation="MTYAYKLMDSPVGQLKLVANGERLAAILWEHDKPNRVRLGELIEA
FT                   NDRPVLIETERQLNEYFAGTRHEFDLPLTFQGTDFQKQVWAALLTIPFGQTRSYSEIAT
FT                   QIGNVNAVRAVGAANGKNPISIVAPCHRVIGASGDLTGFAGGLANKMLLLSLEAGQTSF
FT                   EAEADGQTDMFALEQRATVKTQVKSEAQTKPARHAPSRGTQASLFGN"
     gtgacatacg cctacaaatt gatggactcg cccgtcggcc agttgaaact cgttgcaaac        60
     ggcgagcgcc tcgccgccat tctgtgggag cacgacaagc cgaaccgggt gcgcctcggt       120
     gagctgatcg aagcgaatga ccggcctgtg ctgatcgaga ccgaacggca gttgaacgag       180
     tatttcgccg gcacgcggca tgagttcgac cttccgctga ccttccaggg aacggacttt       240
     cagaagcagg tgtgggccgc gctgttgacc atcccgttcg gccagacgcg cagctactcg       300
     gaaatcgcga cgcagatcgg caacgtcaat gcggtgcggg cggtcggcgc ggcgaacggc       360
     aagaatccga tttccatcgt ggcgccgtgc caccgggtga tcggcgcgtc cggcgatttg       420
     accggctttg cggggggatt ggcgaacaag atgctgctgc tgtcgctaga agccgggcag       480
     acttcgttcg aagcggaagc ggacgggcaa acggacatgt tcgcgctcga acaaagggcg       540
     acggtcaaga ctcaggtcaa atccgaagcc cagacgaaac ccgcgcgcca cgcgccgagt       600
     cgcggcacgc aagcgtcatt gttcggaaat tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page