(data stored in ACNUC7421 zone)

EMBL: CP001053.PE142

CP001053.PE142       Location/Qualifiers
FT   CDS_pept        complement(175511..175942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4133"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B0559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18517"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ6"
FT                   /protein_id="ACD18517.1"
FT                   /translation="MKAKTLICATALAAICASQGAYAQIAGLQPLGGTVEQTNALLKGW
FT                   SVRRALVDEPVYNDLNDKIGSIYDVIISPDRKATYAVVSVGGFLGMGKHYVAIPVDHFE
FT                   IRDGNLFLAGATKDALKSVPEFEYNKLEKATKPRKVKAE"
     atgaaagcaa aaacactcat ctgcgcgacc gctctcgccg ccatctgcgc ctcacaaggc        60
     gcctatgcgc agattgccgg actgcaaccg ctcggcggca cggtcgagca aaccaatgcg       120
     ctgctaaagg gctggagcgt gcggcgcgcg cttgtcgacg agccggtcta caacgatctg       180
     aacgacaaga tcggcagcat ctacgacgtg atcatttcgc cggaccgtaa ggcgacgtat       240
     gcggtcgtat cggtgggcgg cttcctcggc atgggcaagc actatgtggc gattccggtc       300
     gatcacttcg agatccgcga cggcaatctg ttcctcgccg gcgcgacgaa agatgcgttg       360
     aagtcggtac ctgagttcga atacaacaag ctcgaaaaag ccaccaagcc gcgcaaggtc       420
     aaggcggaat aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page