(data stored in ACNUC7421 zone)

EMBL: CP001053.PE147

CP001053.PE147       Location/Qualifiers
FT   CDS_pept        complement(179969..180475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4138"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: bxe:Bxe_B0562
FT                   methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4138"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18522"
FT                   /db_xref="GOA:B2TEJ8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ8"
FT                   /protein_id="ACD18522.1"
FT                   /translation="MTTQTETAILAGGCFWGMQDLLRRYPGVLSTRVGYTGGDVPNATY
FT                   RNHGTHAEALEIVFDPSQISYRKILEFFFQIHDPTTKNRQGNDTGMSYRSAIFYLDDEQ
FT                   KRVAENTIADVEASDLWPGKVVTEVAPAGPFWEAEPEHQDYLERIPNGYTCHFVRPNWK
FT                   LPERG"
     atgacgacgc aaaccgaaac cgccatcctg gccggcggct gcttctgggg catgcaagac        60
     ctgctgcggc gttaccccgg cgtgctatcc acgcgcgtgg gctacaccgg cggcgacgtg       120
     cccaacgcca cttaccgcaa ccacggcacg catgccgagg cgctcgagat cgtgttcgac       180
     ccaagccaga tcagctatcg caagatcctc gagtttttct tccagattca cgatccaacg       240
     acgaagaacc gccagggcaa cgataccggc atgagctacc gctcggccat cttctatctc       300
     gacgatgagc agaagcgagt ggccgagaac accatcgccg acgtcgaggc ttccgatctc       360
     tggcccggca aggtggtcac cgaagtcgct ccggccggcc cgttctggga ggctgagccg       420
     gaacatcagg actatctgga gcgcattccc aacggctaca cgtgccattt cgtccgtccg       480
     aactggaagc tgccggagcg cggctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page