(data stored in ACNUC7421 zone)

EMBL: CP001053.PE15

CP001053.PE15        Location/Qualifiers
FT   CDS_pept        complement(18986..19756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4004"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: bxe:Bxe_B0477 protein
FT                   serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18390"
FT                   /db_xref="GOA:B2TE69"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE69"
FT                   /protein_id="ACD18390.1"
FT                   /translation="MTCASQFRWTSSARSDAGRVREINEDSCLDQSALGRWAVADGMGG
FT                   HAVGDLASRLVIDALSRLTPPVSMKSFVADARARLQTANRQLREEAARRQVQRIGSTVV
FT                   ALLACDRFCGYIWAGDSRLYLLREGSLRQLTRDHSQVEALKSLGVLTEEEARHHPAQHM
FT                   ITRAVGATDLLELDDDVIEVADGDVFLLCSDGLSNEVSEDDMLAVMSNAACANACEELV
FT                   DMALARGGRDNITAVVVRAEDPNAADKTLLNPSP"
     gtgacctgtg cgagccaatt tcgctggacg tcgtccgcgc gttccgacgc cgggcgtgtc        60
     cgcgaaatca acgaagattc ctgtctcgac cagtccgcgc tcggacgctg ggccgtcgcc       120
     gacggcatgg gcgggcacgc ggtcggcgat ctggcgagcc gtctggtaat cgacgcgctc       180
     agccggctca cgccgcccgt cagcatgaag tccttcgtcg ccgatgcgcg cgcgcgtctg       240
     cagaccgcca atcgtcagct aagggaagaa gccgcgcgcc gccaggtaca gcgtatcggc       300
     agcacggtcg tcgcgctgct cgcctgcgat cgcttttgcg gctacatctg ggccggcgac       360
     agccgcctct acctgctgcg cgaaggcagc ctgcggcaac tcacgcgcga ccacagtcag       420
     gtggaagcgt tgaagtcgct cggcgtgctt actgaagaag aggcgcggca tcatccagcg       480
     caacacatga tcacgcgcgc cgtgggcgcc accgacctgc tcgaactgga cgacgatgtg       540
     atcgaggtcg cggatggcga cgtcttcctt ctctgcagcg acggcctgag caacgaagtc       600
     agcgaagacg acatgctcgc tgtgatgagc aatgcggcat gcgcgaacgc gtgtgaggaa       660
     ctcgtcgata tggcgctcgc tcgcggcggc cgcgacaaca tcaccgccgt ggtcgtgcgc       720
     gctgaagacc ctaatgccgc ggacaaaacg ctgctgaatc cgtcgccttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page