(data stored in ACNUC7421 zone)

EMBL: CP001053.PE150

CP001053.PE150       Location/Qualifiers
FT   CDS_pept        181701..182837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18525"
FT                   /db_xref="GOA:B2TEK4"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK4"
FT                   /protein_id="ACD18525.1"
FT                   /translation="MIPEDDRKIDADAQNRAASDGIRGEAAGEGGRGVIRSAATWLEQL
FT                   DPGTHRRIKGLRLVTAYGIAAALGTLQDVTHGLPGATLVGSLAGNFALWASVSEARVSR
FT                   PESSRDLAFLCAAAVLGAAMFIAFAPILQTLGAAGPELTLVTGAFLVGYLKRFGILGAG
FT                   MGSQIFIGQLLAYNIHLTPVDMPAVLVAGLIAMLASIVPRLLSGPAERPALTVLSPVDM
FT                   PDRWKLSAELIMGLQAASGALVVVVLNETIGLKESAWAITASTYVVAGSASGTAERVRR
FT                   RIIGTLVGVPLGLACLPLVEHVPLLAWAAVAAAMIIYAMALPERYDIACGAFAVTLIVT
FT                   LAIGGVHSISFLGARAWETLLGGVVGLLAAKFIFPLRV"
     atgatcccgg aggacgacag aaagatcgac gccgacgcgc aaaaccgcgc ggcgagcgac        60
     ggcattcgcg gtgaggcggc cggcgagggc ggacgtggcg tcatacggtc ggcggcgaca       120
     tggctggagc agctcgatcc cggcacgcat cgccggatca agggactgcg gctcgtcacc       180
     gcgtacggga tcgccgccgc gctcggaacc ttgcaggacg tcacccacgg tttgcccggt       240
     gcgacgctgg tcggttcgct ggccggcaat ttcgcgctgt gggccagcgt ctcggaagcg       300
     cgtgtctccc ggcccgaatc cagtcgcgac ctggcattcc tgtgtgccgc cgccgtgctt       360
     ggcgcggcca tgttcatcgc gttcgccccg atcctgcaga ccctcggcgc ggcgggcccc       420
     gaactgacgc tcgtcaccgg cgcgtttctc gtcggctacc tgaagcgctt cggcattctg       480
     ggcgcgggaa tgggctcgca gatattcatc ggccaattgc tggcttacaa cattcacctg       540
     acgcctgtcg acatgccggc cgtcttggtg gcgggactga tcgccatgct tgcgtccatt       600
     gttccgcgtc tgctcagcgg tccggcggag cgtccggccc tgacggtgct ttcgcccgtc       660
     gacatgccgg atcgctggaa actttcggcc gaactcatca tgggcctgca ggcggcgagc       720
     ggcgcgctgg tcgtggtcgt gttgaacgag acgatcggcc tcaaggaatc cgcctgggcg       780
     atcacggcaa gcacctacgt ggtggcgggc tcggcgagcg gcacggcaga acgagtgcgc       840
     aggcggatca tcggcaccct ggtcggcgtg ccgctgggtc tggcctgcct gccgctcgtc       900
     gaacacgtgc cgctgctcgc ctgggccgcc gtcgcggccg ccatgatcat ctacgcgatg       960
     gctttgccag agcgctacga catcgcttgc ggggcgttcg ccgtcacctt gatcgtgacg      1020
     ctggcgatcg gcggcgtgca ttccatttcg tttcttggcg ctcgcgcgtg ggagacgctg      1080
     cttggcggag tggttggact gctggcggcg aaattcatct ttccgctgcg cgtgtga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page