(data stored in ACNUC7421 zone)

EMBL: CP001053.PE154

CP001053.PE154       Location/Qualifiers
FT   CDS_pept        complement(185392..186102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4146"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1786 short-chain alcohol
FT                   dehydrogenase of unknown specificity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4146"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18529"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEK8"
FT                   /protein_id="ACD18529.1"
FT                   /translation="MSTSQKVVVVTGASQGIGAELVNAFRKLDYRVVATARSVKPSEDP
FT                   NILTVAGDIGEPATAQRVIREAIARFGRIDTLVNNAGIFVAKPFTSYTAEDYAKVTAVN
FT                   LNGFFFITQLAIAEMEKHGSGHVVSISTSLVDHAIDGVPSVLASLTKGGLNAATKSLAI
FT                   EYAKKGIRANAVAPGIIKSPMHAEETHAALGALHPVGHMGEMSDIVNAVLFLDSAPFVT
FT                   GEILHVDGGQSAGH"
     atgagcacat cacaaaaagt cgttgtcgtt acgggcgcat cgcaaggcat cggcgccgaa        60
     ctggtcaacg cgtttcgcaa gctcgactac cgcgtcgtcg caaccgcacg ttcggtcaag       120
     ccctcggaag atccgaacat cctgactgtg gcaggcgata tcggcgaacc ggccaccgcg       180
     cagcgcgtga ttcgtgaagc catcgcccgt tttggccgca tcgacacgct cgtcaacaac       240
     gccggcatct tcgttgccaa gcccttcacc agctatacgg ccgaagacta cgcgaaggtc       300
     accgcggtga acctcaacgg cttcttcttc atcacgcagc tggccatcgc cgaaatggaa       360
     aagcacggca gcggccacgt ggtcagcatt tcgacgagtc tcgtcgacca cgccatcgac       420
     ggcgtgccct cggtgctggc ctcgctgacc aagggcggcc tgaacgcggc cacgaagtcc       480
     ctcgcgatcg aatacgcgaa gaagggcatc cgcgcgaacg ccgtcgcgcc gggcatcatc       540
     aagtcgccga tgcacgctga agaaacccat gcggcgctcg gcgcattgca tccggtcggg       600
     cacatgggcg aaatgagcga tatcgtgaac gctgtgctgt tcctggactc ggcgccgttc       660
     gtgacgggcg aaatcctgca cgtcgacggc ggccagagcg caggccactg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page