(data stored in ACNUC7421 zone)

EMBL: CP001053.PE157

CP001053.PE157       Location/Qualifiers
FT   CDS_pept        189796..192963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4149"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   rme:Rmet_1702 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18532"
FT                   /db_xref="GOA:B2TEL1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL1"
FT                   /protein_id="ACD18532.1"
FT                   /translation="MKFAHFFIDRPIFASVLSIILVVAGTVAMFNLPIAQFPDIAPPTI
FT                   TVSATYPGASAEVVAQNVAAPLEQQVNGADNMMYMNSSSSSTGNMTLTAYFNIGTDPSL
FT                   AQVDVQNRVNLALPTLPDSVTAQGVSVQKRSSAFMMVIAIYSPDNAFDQSYVANYANVY
FT                   VLDALKRIPGANQASIFGSADYAMRIWIKPDRMAKLSITVADVQQAISNQNQQFSAGRL
FT                   GQSPTNAPVQQTFPVATKGRMTKPADFDNIILRAGSGDASTIRIKDIGHAELGAKDYSL
FT                   RGRYNGKTATLIAVYQQPGANALQVAKQVHATLEQLQKAFPPGLKYEVALDTTEFVQES
FT                   IGEVIHTLRDAVILVILVVFIFLQSFRATLVPLLAVPVSILGAFIGMLVFGFSVNMLTL
FT                   FGMVLAIGIVVDDAIVVIENVERNMTEFGLPPKEAAKHAMDEVTGPVIAIVLVLLAVFI
FT                   PVAFLSGITGQLYKQFAVTIAVSVVISGIVALTLSPALAAILLKPGTHKKNRFFLWFNK
FT                   RFDRLTQGYGRAVQLAIRRVALSILLIVAMVAATAGLFKHIPSSFLPTEDQGYLLGAVV
FT                   LPDAASLDRTGNLSQRAEQWFAKQPAVKSVAAPIGYSLIDSQYKSNAGTLFITLKGFKD
FT                   RGENGTAQDLIRDANKAFSGYTDGVVVPLNPPSIPGLGTTGGFEFWLQSTGDGSYQNLE
FT                   EKVRAFIAKARQNPALRGVNSTINTNSRQLLVEVDRERAESLGVPIQDIYAALQTMFGS
FT                   SYVSQFPKSSRLFQVIVQAEPQYRTQPDDIQQLYVRNRSGDMVPIKAVTTVRFVPGADI
FT                   VTRFNNFPAAKITGDAAPGHSSGESIAAMEQIAHEVLGEGYSYAWSGQAYEEKQAGSTA
FT                   ILVFGFALLMVFLILAAQYEKWSLPIGVLLAVPFAIFGALIGILLRGMEDDVYFQIGLT
FT                   VLIALAAKNAILIFEFAVEMREKEALSPYDAALKAAKLRLRPIIMTSLAFILGCVPLAI
FT                   ASGASAASRRSLGTGVIFGMLGATVIALFFIPMFFWGLETLSSRGKKAPAPDAGPPVSP
FT                   GPREGGT"
     atgaagttcg cccacttttt tatcgaccgg ccgatcttcg cgtcggtgct gtcgatcatc        60
     ctcgtggtgg ccggcaccgt cgcgatgttc aacctgccga tcgcgcagtt ccccgatatc       120
     gcgccgccga ccatcaccgt gagcgcgacc tatccgggcg caagcgcgga ggttgtcgcg       180
     cagaatgtcg cggcgccgct cgagcagcag gtaaacggcg cggacaacat gatgtacatg       240
     aactcgtcca gctcgtcgac cggcaatatg acgctgacgg catacttcaa catcggcacg       300
     gatccgtcgc tggcgcaggt ggatgtgcag aaccgcgtga atctggcgct gcccacgctg       360
     cccgattcgg taacggcgca aggcgtgtcg gtgcagaagc gctcgtcggc gttcatgatg       420
     gtgatcgcga tctactcgcc ggacaacgcg ttcgatcagt cgtacgtcgc gaactacgcg       480
     aacgtctatg tgctcgacgc gttaaagcgc attccgggcg cgaaccaggc atcgattttc       540
     ggttcggccg actacgccat gcgtatctgg atcaagcccg accgcatggc gaaactctcc       600
     atcaccgtcg ccgatgtgca gcaggcgatc agcaaccaga accagcaatt ttccgcgggc       660
     cgcctcggcc agtcgcccac caacgcgccg gtccagcaga cctttccggt ggcgaccaaa       720
     ggccgcatga ccaagcctgc cgatttcgac aacatcatct tgcgcgccgg ttcgggcgac       780
     gcgtcgacca tccgcatcaa ggatatcggc cacgcggaac tgggcgcgaa agattattcg       840
     ctgcgcgggc gctacaacgg caaaaccgcg acgctgatcg ccgtgtatca gcagccgggc       900
     gccaacgcgc tgcaagtcgc caagcaggtg catgccacgc tcgagcagct gcaaaaggcc       960
     tttcctcccg gcctgaaata tgaagtcgcg ctggatacga cggagttcgt gcaggaatcg      1020
     atcggtgaag tcattcacac gttgcgcgac gcggtgatcc tcgtgattct cgtcgtgttc      1080
     attttcctgc agagctttcg cgcgacgctc gtaccgcttc tcgccgtgcc cgtgtcgatt      1140
     ctcggcgcgt tcatcggcat gctggtgttc ggcttttcgg tcaacatgct gaccttgttc      1200
     ggcatggtgc tggccatcgg catcgttgtg gacgatgcga tcgtggtgat cgagaatgtc      1260
     gagcgcaata tgaccgagtt cggtctgccg ccgaaagagg ccgccaaaca cgcaatggac      1320
     gaagtgaccg ggccggtcat cgcgatcgtg ctcgtgctgc tcgcggtatt tattccggtg      1380
     gcgtttctgt ccggcatcac ggggcagttg tacaaacagt tcgcggtgac gatcgccgtc      1440
     tcggtcgtga tctcaggcat tgttgcgttg acgctgtcgc cggcgcttgc cgcgattctg      1500
     ctcaagcccg gcacgcacaa gaagaaccgc ttctttctct ggttcaacaa gcgtttcgac      1560
     cgcctgacgc aaggctatgg acgcgcggtg caactcgcga tacgccgcgt cgcgttgtcg      1620
     atcctgctga ttgtggcgat ggtggcggcg accgcggggc tgttcaaaca cattccctcg      1680
     tcgttcctgc ccaccgaaga tcagggctat ctgctcggcg cggtggtgct gcccgatgcg      1740
     gcgagcctcg accgcaccgg caacctctcg caacgcgcgg aacaatggtt cgctaagcag      1800
     cctgctgtca aatcggtcgc cgcgccgatc ggctacagcc tgatcgactc gcagtacaag      1860
     tcgaacgcgg gcacgctgtt catcacgctc aaaggcttca aggatcgtgg cgagaacggc      1920
     accgcgcaag acctgatccg cgatgcgaac aaggcgtttt ccggctacac ggacggcgtg      1980
     gtagtgccgc tgaatccgcc gtccattccc gggctcggca cgaccggcgg cttcgagttc      2040
     tggctgcaaa gcaccggcga cggcagctat cagaaccttg aagagaaggt gcgcgcgttc      2100
     attgcgaagg cgcgtcagaa cccggcgttg cgtggcgtca actcgaccat caatacgaac      2160
     tcgcggcagt tgctcgtcga ggtcgaccgc gagcgcgcgg aatcgctcgg tgtgccgatt      2220
     caggacattt acgccgcgtt gcagaccatg ttcggctcct cgtatgtgag tcaattcccg      2280
     aagagcagcc ggctctttca ggtgatcgtg caagccgagc cgcaataccg cacacagccc      2340
     gacgacatcc agcaactcta cgtgcgcaac cgcagcggcg acatggtgcc gatcaaggcc      2400
     gtcacgaccg tccgtttcgt gccgggcgcc gacatcgtca cgcgcttcaa caattttccc      2460
     gccgcgaaaa tcaccggcga tgccgcgccg ggacacagtt cgggagaatc catcgccgcg      2520
     atggagcaga tcgcgcacga ggtgctcggc gaaggttata gctatgcatg gagcggccag      2580
     gcctacgaag aaaagcaggc cggctcgacc gcgattctcg tattcggttt tgccttgctg      2640
     atggtgttcc tgatcctcgc ggcccaatac gaaaagtggt cgttgccgat cggcgtgcta      2700
     ctggcggtgc cgttcgcgat attcggcgcg ctcatcggca ttctgttgcg cggcatggaa      2760
     gacgacgtgt acttccagat cggcctgacc gtgctgatcg cgctcgcggc gaagaacgcg      2820
     attctgatct tcgagttcgc cgtcgagatg cgcgagaagg aagcgctgtc cccctacgac      2880
     gccgcgctca aagccgcgaa gctgcggctg cggccgatca tcatgacatc gctggcgttc      2940
     attctcggtt gcgtgccgct ggcgatcgcg agcggcgcgt cggctgcgag ccgccgctcg      3000
     ctcggcaccg gtgtgatctt cggcatgctc ggtgcgacgg tcatcgcgct gttcttcatt      3060
     ccgatgttct tctggggact cgaaacattg tcgtcgcgcg gcaagaaggc gccggcgccc      3120
     gatgccggac cgccggtgtc gccggggccg cgggagggag ggacatga                   3168
//

If you have problems or comments...

PBIL Back to PBIL home page