(data stored in ACNUC7421 zone)

EMBL: CP001053.PE158

CP001053.PE158       Location/Qualifiers
FT   CDS_pept        192960..194378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4150"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rme:Rmet_1703 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18533"
FT                   /db_xref="GOA:B2TEL2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL2"
FT                   /protein_id="ACD18533.1"
FT                   /translation="MRFPRCRLLAAVCACWFAGCTVGPDYHRPAVDTPSSFRYASPDAE
FT                   VVDQGAVQWWSQFNDPVLDGLIQRALDQNKDLAIAAARVDEFYGRLMTTRAGLFPQVGA
FT                   NFGGGRGRSVPAPGFAPAVGNQVQLDVMASWEIDLFGRLRRLTEAARADYLGTQAAQQA
FT                   TRIALISSVATSYLLLRDLDQRLEIAKSTLASRADALSLFQERFTGGVVSQLQVSQAKS
FT                   EYESAQASVYAFQQQIAQQENALSLLLGDNPGPIPRGKPLTQLSAPAIPAGLPSSLLER
FT                   RPDILQAEQALVSANASIGAARAQYFPSISLTGMFGAASTALSGLWTGPARIWSFAGAI
FT                   SQPIFTGGAITGSVRTAEAQQQEALFSYEQAIQSAFADVENALVGVARVRDQLQATNRQ
FT                   VEALAQYASLARDLYEGGYTSYLEVLDAERSLFNAQLQQSQLQDQQLAEIVALYKALGY
FT                   GWNVDSGSQTPTRG"
     atgagattcc ctcgatgccg cttattggcc gctgtttgcg cctgctggtt cgcgggctgc        60
     acggtcggcc ccgactatca ccggcctgct gtcgacacac cgtcgtcgtt ccgctatgcg       120
     tcaccggacg ccgaagtggt cgatcagggc gccgtgcaat ggtggagcca gttcaacgat       180
     ccagtgctcg atggcctgat ccaacgggcg ctcgatcaga acaaggacct cgccatcgcg       240
     gccgcgcgcg tcgacgaatt ctacggacgc ctgatgacca cgcgtgccgg gctcttccca       300
     caagtcggtg cgaacttcgg cggcgggcgc ggccgcagcg tgcccgcgcc gggcttcgcg       360
     ccggcggtcg gcaatcaggt gcaactggac gtgatggcgt cgtgggaaat cgatctgttc       420
     ggccgcctgc ggcgcctgac cgaagccgcg cgcgccgatt atctcggcac tcaggccgcg       480
     cagcaggcga cccgtatcgc gttgatctcc agtgtggcga cctcgtatct gttgctgcgc       540
     gatctcgacc agcggctgga aatcgcgaag tcgacgctcg ccagccgtgc tgatgcgctc       600
     tcgctgtttc aggagcgctt caccggcgga gtcgtgtcgc aacttcaggt gagtcaggcg       660
     aagtccgaat acgagtcggc gcaagcatcc gtgtacgcat tccagcagca gatcgcgcaa       720
     caggaaaacg cgttgtcgct gctgctcggc gacaaccccg gaccgatccc gcgcggcaag       780
     ccgttgacgc aactcagcgc gcccgcgatc ccggcgggcc tgccgtcgtc gctgcttgaa       840
     cgacggcccg atatcttgca agccgaacag gctttggtct ccgcgaacgc gtcgattggc       900
     gcggcgcgcg cgcagtactt cccgagcatt tcgctgacgg gcatgttcgg cgcggcgagc       960
     acggcgctct ccggactgtg gacggggccg gcgcgcatct ggtcgtttgc gggcgcgatc      1020
     tcgcagccga tcttcaccgg cggcgcgatc acaggatcgg tgcgcaccgc cgaggcgcag      1080
     cagcaagagg cgctgttcag ctacgagcag gctatccagt ccgcttttgc cgatgtggag      1140
     aacgccttgg tcggcgtggc gcgcgtgcgt gaccagttgc aggcgaccaa tcgccaggtc      1200
     gaggcgcttg cgcaatatgc ttcgctcgcg cgcgatttat acgaaggcgg ctatacgagc      1260
     tacctggaag tgctcgacgc cgagcgcagt ctgttcaatg cgcagcttca gcagtcgcaa      1320
     ttgcaggacc agcagcttgc cgagatcgtc gcgttgtaca aggcgcttgg ctatggctgg      1380
     aacgtcgaca gcggctcgca gacgccaacg cgcgggtga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page