(data stored in ACNUC7421 zone)

EMBL: CP001053.PE16

CP001053.PE16        Location/Qualifiers
FT   CDS_pept        complement(19762..20049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18391"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE70"
FT                   /protein_id="ACD18391.1"
FT                   /translation="MASITVSDLSLNLALDRKAMTAIRGGGGAPWVYGWIQPYVRDTPS
FT                   IGPVVNLYDVTNNFYANQMINTFQSVDVRNTGANSNISVSPDARSRNDMV"
     atggcttcta ttacagtaag cgacctctcg ctgaacctcg cgctagaccg taaagcgatg        60
     acagcgatcc gcggcggcgg cggcgccccg tgggtgtacg gctggattca gccctacgta       120
     cgcgatacgc cgagcattgg gcccgtcgtg aacctgtacg acgtgaccaa caacttctat       180
     gctaaccaga tgatcaacac gttccagtcg gtcgatgtac gcaacaccgg cgcgaactcg       240
     aacatcagtg tctctcccga cgcacgcagc agaaacgata tggtgtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page