(data stored in ACNUC7421 zone)

EMBL: CP001053.PE160

CP001053.PE160       Location/Qualifiers
FT   CDS_pept        complement(194862..195305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18535"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL4"
FT                   /protein_id="ACD18535.1"
FT                   /translation="MESHPFRVLAALLVSSAGFCPAVSHAYALDAQFDCQARPHTFITQ
FT                   LIDDNYIESKPMRVDKNSVNAFRPVHGSDMTVFGFRVYAVLGYEPDDDMFKKGRGQALA
FT                   GPLYGVVLSAPSESVETRVRAAGSTAKVHSVIPLLLTALICTD"
     atggaatctc atcctttcag agtgcttgcc gcactcctcg tttcaagcgc cggcttctgc        60
     ccggcggtat cgcatgccta cgcgctcgac gcacagttcg actgtcaggc gcgtccccac       120
     acgttcatca cccaactcat cgacgacaac tacatcgagt ccaagccgat gcgggtcgac       180
     aagaactccg tcaacgcgtt tcgtcccgtg cacggcagcg acatgaccgt gttcggcttt       240
     cgcgtctacg cggtgctcgg ctacgagccg gacgacgaca tgttcaagaa gggccgcggc       300
     caggcactcg cgggcccgtt atatggcgtc gtgctgtccg cgccgagcga gtcggtcgaa       360
     acgcgcgtgc gcgcggccgg aagcaccgcc aaggtgcact cggtcattcc gttgttgctg       420
     accgcgctga tctgcacaga ttga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page