(data stored in ACNUC7421 zone)

EMBL: CP001053.PE162

CP001053.PE162       Location/Qualifiers
FT   CDS_pept        complement(196631..197530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4154"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0570 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18537"
FT                   /db_xref="GOA:B2TEL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL6"
FT                   /protein_id="ACD18537.1"
FT                   /translation="MELKLLRAFLTVAELRHFGHAAEALYVSQPALSKQIVALEASLGA
FT                   RLFERGRHGAELTIFGEGFLADAEALVRDADNILARAREASSGTRGYLRVGLGLSTLTE
FT                   APQLIAQFRKLHPNVSVTLNDLSSAEQSRRLLGGKLDVGFLRLPADAGLSTLPILDEAL
FT                   ALAIPQYARWKRVPSNLQELNEPGFIALSRGRGPGLAAQIDHWCGEHGFVPKVIQQADD
FT                   IQSVLAGVAAGVGAAFLPSRAQYLLRDARVLPLRDAAARWRVALAWQTTRDDPVVANFV
FT                   AFVRAAKKSLRAGSAAPG"
     atggaactca aactcctgcg cgcctttctg accgtcgctg aactccgcca cttcgggcac        60
     gccgccgaag cgctttatgt cagccagccc gctctgagca agcagatcgt ggcgttggaa       120
     gcgagccttg gcgcgcggct gttcgagcgc ggacggcacg gcgcggagct gaccatcttc       180
     ggcgaaggat ttcttgccga cgccgaggcg ctggtccgcg acgcggacaa tatcctcgcg       240
     cgtgcgcgcg aggcgagcag cggcacgcgt ggctatctgc gcgtcggcct cggactttcg       300
     acgttgaccg aagcgccgca actgatcgcc caattccgca agctccatcc gaacgtcagc       360
     gtgacactca acgatctgtc ttccgcggag cagtcccggc ggcttctcgg cggcaagctc       420
     gatgtcggct tcctgcgctt gcccgccgac gccggcctgt ccaccttgcc gatactcgac       480
     gaggccctgg cattggcgat accgcagtac gcacgctgga aacgcgttcc gtcgaatctg       540
     caggaattga acgagcccgg cttcatcgcg ctgtcacgcg gacgcggtcc cggcctcgcg       600
     gcacaaatcg atcactggtg cggtgagcat ggcttcgtgc ccaaggtaat ccagcaagcc       660
     gacgacattc aatcggtcct tgccggcgtg gcggcgggcg tgggcgcggc gttcctgccg       720
     tcacgcgcgc aatacctgtt acgcgacgcg agagtgctgc cgttgcgcga tgccgccgca       780
     cgctggcggg tggcactggc gtggcagacc acgcgcgacg atcccgtggt ggcgaatttc       840
     gtcgcgttcg ttcgcgcggc gaagaagtcc ctgcgtgccg gttccgctgc gccgggttga       900
//

If you have problems or comments...

PBIL Back to PBIL home page