(data stored in ACNUC7421 zone)

EMBL: CP001053.PE165

CP001053.PE165       Location/Qualifiers
FT   CDS_pept        199674..200639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4157"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0573 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18540"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEL9"
FT                   /protein_id="ACD18540.1"
FT                   /translation="MIRHFLPARRRAIAAGAAFLAVSILPMPAAFAQAAHKPKVALVMK
FT                   SLANEFFLTMETGAKDYQKQNPAKFDLVTNGIKDETDTANQIRIVEQMIVSKVDALVIA
FT                   PADSKALVPVLKKAVDAGIIVVNIDNKLDNDVLKSKDLNIPFVGPDNAKGAQKVGDYLA
FT                   KHLKSGDNVGIIEGVTTTTNAQQRTAGFKQAMAAGGMKVVALQSGEWEIDKGNAVASQI
FT                   LNANPDVKALLCGNDNMAIGAVSAVRAAGKAGKVQIVGYDDINAIKPMLKDGRVLATAN
FT                   QYAAKQAVFGIDTALKALSEHKKQSELSGVVETPVDLVTK"
     atgattcgcc atttccttcc ggcgcgccgt cgcgccatcg cagccggcgc agctttcctc        60
     gctgtgtcga ttttgccgat gccggcagcc ttcgcccagg ccgcccataa accgaaagtc       120
     gcgcttgtca tgaagtcgct ggcaaacgag ttcttcctga ccatggaaac gggcgccaag       180
     gattatcaga agcagaatcc ggcgaagttc gatctcgtca ccaacggcat caaggacgag       240
     acggacaccg cgaaccagat ccgcatcgtc gagcagatga tcgtctcgaa ggtcgacgcg       300
     ctggtgatcg cgccggctga ctcgaaggcg ctggtgccgg tcctgaagaa ggcggtcgat       360
     gccggcatca tcgtggtcaa tatcgacaac aagctggata acgacgtcct caagtcgaaa       420
     gacctgaaca tcccgttcgt cgggccggat aacgcgaagg gcgcgcagaa ggtcggtgac       480
     tacctggcca agcacctgaa atcgggcgac aacgtcggca ttatcgaagg tgtcacgacc       540
     acgaccaacg cgcagcaacg cacggccggc ttcaagcagg ccatggcggc gggcggcatg       600
     aaggtcgtcg cgctgcaatc gggcgagtgg gaaatcgaca agggcaacgc cgtcgcgagc       660
     cagatcctca acgcgaatcc ggacgtcaag gctttactgt gcggcaacga caatatggcg       720
     atcggcgccg tgtcggccgt gcgggcggcc ggcaaggcag gcaaggtgca gatcgtcggt       780
     tacgacgaca tcaacgcgat caagccgatg ctcaaggacg gccgcgtact cgccaccgcc       840
     aatcaatacg cagccaagca ggccgtgttc ggcatcgaca cggctttgaa ggcgctctcc       900
     gaacacaaga agcagtctga attgtccggc gttgtcgaaa cgccggtcga tctggtcacc       960
     aagtaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page