(data stored in ACNUC7421 zone)

EMBL: CP001053.PE167

CP001053.PE167       Location/Qualifiers
FT   CDS_pept        202328..203329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4159"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0575 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18542"
FT                   /db_xref="GOA:B2TEM1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM1"
FT                   /protein_id="ACD18542.1"
FT                   /translation="MTVETSLPTLQNEPPKNAKPLGTRLGLSNYLGLLGALLGMIVLFS
FT                   LLSSHFLTYDTFSTIANQIPDLVVMSIGMTFVLIIAGIDLSVGSVLALGAALTSVAALQ
FT                   WHWPALPAALLGMAGATLTGCVTGAITVAWRIPSFIVSLGVLEAARGLAYQLTNSRTAY
FT                   IGDAFDFLSNPVAFGISPAFIIAIVVMVAAQFVLTRTVFGRYLVGIGTNEEAVRLAGVN
FT                   PRPYKIAVFAMMGLLAGLASLFQISRLEAADPNAGQGIELQVIAAVVIGGTSLMGGRGS
FT                   VTSTFFGVLIISVLAAGLAQIGATEPTKRIITGAVIVVAVVLDTYRSRRRAG"
     atgaccgtgg aaaccagcct gcctacgctg cagaacgaac cacccaaaaa cgcgaagccg        60
     ctcggcacgc gactcggatt gtcgaactac cttggattgc tcggtgcgct cctcgggatg       120
     atcgtgttgt tctcgctgct gagttcgcat ttcctcactt acgacacctt cagcacgatt       180
     gccaaccaga ttcccgatct cgtcgtcatg tcgatcggca tgacgttcgt gctgatcatt       240
     gccggcatcg atctgtcggt cggctcggtg ctggcgctcg gcgcagcgct cacaagcgtc       300
     gcggccttgc agtggcattg gccggcgttg cctgccgcgt tgctcggcat ggcgggcgcg       360
     acgctgaccg gctgcgtgac gggcgcgatc accgtggcgt ggcggattcc gtcgttcatc       420
     gtgtcgctcg gcgtgctcga agcggcgcgt ggtcttgcgt atcagctgac caactcgcgc       480
     accgcttata tcggcgatgc cttcgatttc ctctccaacc cggtcgcgtt cggcatctcg       540
     ccggcgttca tcatcgccat tgtggtgatg gtcgccgcgc agttcgtgtt gacgcgtacg       600
     gttttcggcc gctatctggt cggcatcggc acgaatgagg aagccgtgcg gctcgcgggc       660
     gtcaatccgc gaccctacaa gatcgccgtg ttcgcgatga tgggtttact tgccggcctc       720
     gcttcgttgt tccagatttc gcggctcgag gccgcggacc cgaatgccgg gcaaggtatc       780
     gaattgcagg tgatcgcggc ggtggtgatc ggcggaacga gtttgatggg cggacgtggt       840
     tcggtgacga gcacgttctt cggagtgttg atcatttcgg tgctcgctgc gggtctcgcg       900
     cagatcggcg cgaccgagcc gaccaaacgc atcattacgg gagctgtgat tgtggtggct       960
     gtcgtgctgg atacttatcg aagccggcgt cgcgctggat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page