(data stored in ACNUC7421 zone)

EMBL: CP001053.PE168

CP001053.PE168       Location/Qualifiers
FT   CDS_pept        203468..204400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4160"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: bxe:Bxe_B0576
FT                   putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18543"
FT                   /db_xref="GOA:B2TEM2"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM2"
FT                   /protein_id="ACD18543.1"
FT                   /translation="MSKETKQGRVLVVGSINTDLVARAPHLPRPGETIGGHEFSQVAGG
FT                   KGGNQAVAAARIGAQVAMVGCVGKDANGAQRVKDLEAEGIDCSGIEVHPGQPTGVAMVT
FT                   VSDDGQNTIVVVAGSNGELTPESVARHEAAIKACDVVVCQLETPWDSVHATLALARRLG
FT                   KITVLNPAPATGPLPAEWLPLVDYLVPNEVEAAILAGLPVESQSGARRAATELQQGGAR
FT                   NVIVTLGAQGAYLLVEGGEGMHFPAPQVQAVDTTAAGDTFIGVFAAQLASRQPLESAIS
FT                   LAQRAASISVTRAGAQPSIPTRAEVDSAA"
     gtgtcaaaag aaacgaagca gggccgcgtg ctggtagtgg gaagcatcaa tacggatctc        60
     gtcgcgcgcg cgccgcattt gccgcgcccc ggcgagacga tcggcggaca tgagttctcg       120
     caggtcgccg gcggcaaggg cgggaaccag gcggtcgcgg ccgcgcgcat cggcgcacag       180
     gttgcgatgg ttggatgcgt cggcaaagac gcgaacggcg cgcaacgcgt caaggatctg       240
     gaagcggaag ggatcgactg cagcggcatt gaggttcatc caggtcagcc gaccggtgtc       300
     gccatggtga cggtgtccga cgacgggcag aacacgatcg tcgtggtggc cggcagcaac       360
     ggcgaactca cgccggagag cgtggcgcgc catgaagcgg ccatcaaggc ctgcgacgtc       420
     gtggtgtgtc aactggaaac accgtgggat tccgttcacg cgacgctcgc actcgcgcgc       480
     cggctcggca agatcaccgt gttgaacccg gcgccagcca ccgggccgtt gccggcggaa       540
     tggctgccgt tggtcgacta cctcgtgccg aacgaggtcg aggccgccat tctggctggc       600
     ctgccggtcg aatcgcaaag cggtgcgcgg cgcgcggcga cggagctgca acagggcggc       660
     gcgcgcaatg tgatcgtcac gctcggcgca cagggcgcct atctgctggt ggaaggcggc       720
     gagggcatgc actttcccgc gccgcaggtg caagcagttg atacgaccgc ggccggcgac       780
     acttttatcg gcgtcttcgc cgcgcaactc gcttcacggc agccgctgga aagcgcaatc       840
     agcttggcgc aacgcgccgc gtcgatttcc gtgacgcgcg cgggcgcgca gccttcgata       900
     ccgacccgcg cggaagtcga tagcgcagcc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page