(data stored in ACNUC7421 zone)

EMBL: CP001053.PE175

CP001053.PE175       Location/Qualifiers
FT   CDS_pept        complement(212053..212787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4167"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0580
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18550"
FT                   /db_xref="GOA:B2TEM9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEM9"
FT                   /protein_id="ACD18550.1"
FT                   /translation="MKEATSRRKTSAPLKTPAPAHTSTDHASREKPYHHGALPHALLEA
FT                   AEVVLRRDGIRGLTLRAIAREAGVSHTAPQHHFGDTAGVLSELAASGHRRLAATMAEQA
FT                   DGIEAGQARRKAIARGYVSFAVANPDLLHLMSRNEMLDAQRPALVQARLASARALAGVV
FT                   IAPTDHAEEDKSSFGRITAAQATAMTAAWAYVHGLALLLIDGRLNALAASADGIRSAED
FT                   LVEAAIEHVQIVPAYPTGKGRK"
     atgaaagaag caacgtcacg ccgtaaaacg tccgcgccgc ttaaaacccc agccccagct        60
     cacacctcaa ccgaccacgc atcgcgcgag aaaccgtatc atcacggcgc gctgccccat       120
     gcgctgctcg aagcggcgga ggtcgtgcta cggcgcgacg gcattcgcgg cctgacattg       180
     cgcgctattg cacgtgaagc cggcgtctcg catacggcgc ctcagcatca tttcggcgac       240
     acagccgggg tgttgagcga acttgccgcg agcggacacc ggcggctcgc cgcgaccatg       300
     gcggagcaag cggacggaat cgaagcgggc caggcgcggc gcaaagccat cgctcgcggc       360
     tacgtgagct tcgcggtggc caatccagat ttgctgcacc tcatgtcgcg caacgaaatg       420
     ctcgacgctc aacgcccggc cctcgtgcag gcgcggctag cgtcggcgcg cgcactggcc       480
     ggcgtagtga ttgcgcccac cgaccacgcg gaggaagaca agtcctcgtt cggccgaatc       540
     accgcggctc aggccactgc catgacagca gcatgggcgt acgttcatgg gcttgctttg       600
     cttctgatcg acggacgcct gaatgcgctg gccgcatccg ccgacggtat tcgcagcgcc       660
     gaagatctgg tggaagccgc catcgagcac gtccagatcg ttcctgccta ccccactggc       720
     aaaggccgaa aatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page