(data stored in ACNUC7421 zone)

EMBL: CP001053.PE179

CP001053.PE179       Location/Qualifiers
FT   CDS_pept        215307..216332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4171"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_C1349 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18554"
FT                   /db_xref="GOA:B2TEN3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN3"
FT                   /protein_id="ACD18554.1"
FT                   /translation="MTSQSDTSALGNKKTFSGLRARVFTPTALQKLLAFGSLILLLVFF
FT                   SFASPAFMQMDNMLGILQATAVNGVLAIACTFVIITGGIDLSVGTLMTFTAVICGVFLT
FT                   YWHLPMWTGVLAAIGTGAICGTVSGTLTAKMKIPPFIATLGMMMLLKGLSLVVSADKPI
FT                   YFTDTENFYMISQDSLIGDLLPSLPVPNAVLILFFLAVVSSITLNRTALGRYTFALGSN
FT                   EEAVRLSGVNVDRWKIAIYGLSGAICGIAGLLIASRLNSAQPALGQGYELEAIAAVVIG
FT                   GTSLSGGAGTILGTIIGAFIMSVLTNGLRIMSVAQEWQIVVTGLIIILAVYGDILRRKK
FT                   S"
     atgacatcgc aatcggacac ttcggcgctg ggtaataaaa agacgttctc aggtctgaga        60
     gcccgcgtct tcacgccgac cgcgttgcaa aagctgcttg cgttcgggag cctgatcctg       120
     ctgctggtgt ttttcagctt cgcgtctccc gcgttcatgc agatggacaa catgctcggg       180
     attctgcagg cgactgcggt gaacggcgtg ctcgcgattg cctgcacgtt tgtaatcatc       240
     accggcggta tcgatctgtc cgtcggcacg ttgatgacct tcacggcggt catttgcggc       300
     gtgttcctca cctactggca tttgccgatg tggaccggcg tccttgccgc gatcggcacg       360
     ggagcaattt gcgggaccgt ttcgggaacg ctgacggcga aaatgaaaat accgccgttc       420
     atcgccacgc tcggcatgat gatgctgctg aaagggctgt cgctggtggt ctcggccgac       480
     aagccaattt atttcaccga caccgaaaac ttctacatga tctcgcagga ttcgctgatc       540
     ggcgatctgc tgccgagctt gcctgtgccg aacgcggtcc tgattctgtt tttcctggcg       600
     gtggtcagtt cgatcacgct caatcgcacg gcgctcggcc gctatacctt cgcgctcggc       660
     agtaatgaag aagcagtgcg cctgtccggt gtgaatgtcg accggtggaa gatcgccatt       720
     tacgggttga gcggcgcgat ttgcgggatt gccgggctac tgatcgcctc gcgtttgaat       780
     tcggcgcagc cggcgctagg ccaaggttac gaactcgaag caatcgcggc cgtggtgatt       840
     ggcgggacat cgcttagcgg cggcgcgggc acgattctcg gcacgatcat tggcgcgttc       900
     atcatgagtg tgctgaccaa cggtctgcgc atcatgtccg tcgcgcagga atggcagatc       960
     gtagtgaccg gtctcatcat cattcttgcg gtctacggcg atattttgcg gcgcaagaaa      1020
     agttga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page