(data stored in ACNUC7421 zone)

EMBL: CP001053.PE180

CP001053.PE180       Location/Qualifiers
FT   CDS_pept        216418..217356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4172"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_C1348 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18555"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN4"
FT                   /protein_id="ACD18555.1"
FT                   /translation="MLKRKLIGVVVGVGALIGGTSVTYADTYIPLISKGFQHQFWQAVK
FT                   SGAEQSAKEHNVRITFEGPETEAMVDKQIDMLSAALAKKPQALGIAALDSKAAIPLLKR
FT                   AQASKIPVIAFDSGVDSDIPLTTCATDNLAAAALAADKMAEAIGNAGEVGVIVHDQTSR
FT                   TGIDRRDGFLNEMKSKHPNIKIVSVQYGGGDHLKSAEIAKTMIQANPNLKGIFGANEGS
FT                   AEGAAIGVKESGKKLVLIGYDSGKEQKDDINSGLMAGAITQNPVGIGKCVVDSAVKALK
FT                   GEKLPKKVDTGFYWYDKTNMTDPKIAAVLYD"
     atgttgaaaa gaaaactaat cggtgtcgtg gtcggcgttg gcgctctcat tggcgggacg        60
     agcgtaacgt acgcggacac ctacatcccg ctcatttcga agggcttcca gcatcaattc       120
     tggcaggccg tcaaatccgg tgccgaacag tcggccaagg agcacaacgt cagaattacc       180
     ttcgagggac cggaaaccga agccatggtc gacaagcaga tcgacatgct ctcggccgcg       240
     ctcgccaaga agccgcaggc actcggcatc gccgcgctcg atagcaaagc ggcaattcca       300
     ctgttaaagc gcgcacaggc ctcgaagata cccgtgatcg ctttcgactc cggcgtggac       360
     agcgatattc cgctgacaac gtgcgcaacg gataacctcg ccgcagccgc actcgctgcc       420
     gacaagatgg ccgaggcaat cggcaatgcc ggcgaagtcg gcgtgatcgt gcacgaccag       480
     acgagccgca ccggcatcga tcgccgcgac ggcttcctca atgaaatgaa atccaagcac       540
     ccgaacatca agatcgtctc agtccaatat ggcggcggcg accatttgaa gtcggcggaa       600
     atcgccaaga cgatgattca ggctaacccg aatctcaagg gcatcttcgg cgcgaatgaa       660
     ggctcggcgg aaggcgccgc gatcggcgtg aaggaatcgg gcaagaagct cgtgctgatc       720
     ggctacgact cgggcaagga acagaaggac gatatcaact cgggattgat ggccggcgcg       780
     attacgcaga acccggttgg catcggcaag tgcgtggtcg actccgcggt gaaggcgctc       840
     aagggcgaga agttgccgaa gaaagtcgac acgggcttct actggtacga caagaccaac       900
     atgaccgatc cgaagatcgc agccgtgctc tacgattga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page