(data stored in ACNUC7421 zone)

EMBL: CP001053.PE181

CP001053.PE181       Location/Qualifiers
FT   CDS_pept        217467..218765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4173"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_C1347 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18556"
FT                   /db_xref="GOA:B2TEN5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN5"
FT                   /protein_id="ACD18556.1"
FT                   /translation="MPTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSAAYVTLETDSPD
FT                   ALTGHGLTFTIGRGNEICVAAVEALAPLIVGKRLEDIAANMGAFWRALTSDSQLRWIGP
FT                   DKGAIHLATAAVVNAAWDLWAKAEGKPVWKLLVDMSPEELVRCLDFRYVTDAITPQEAI
FT                   AMLHRHAKTRGEREKEMLAQGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVG
FT                   GNLDEDMRRARILREEIGEDRKLMMDANQVWDVDEAVANMRRLAQFDPWWIEEPTSPDD
FT                   ILGHAAIRQRLRQIGVATGEHCHNRVMFKQLLQAQAIDFCQVDSCRLGGLNEVIVVLLM
FT                   AAKFGVPVCPHAGGVGLCEYVQHISLFDYICVSASLENRVLEYVDHLHEHFVDPVVIRN
FT                   GRYMPPQRSGYSIEMHAASLDEYDFPEGVAWRG"
     atgcccacga tcaccaggct gtccgtccgc gacattcggt ttcccacctc gcgctcactg        60
     gacggctccg atgcgatgaa cgccgcgccg gattactccg ccgcctacgt cacgctcgaa       120
     accgattcgc ccgacgcact caccggccac ggtctcacct tcacgatcgg acgcggcaac       180
     gagatttgcg tagccgcggt cgaggcgttg gctccgttga tcgtcggtaa aaggctggag       240
     gatatcgccg cgaacatggg cgctttctgg cgcgcgctga cgtcggatag ccagttgcgc       300
     tggatcggcc cggacaaagg cgcgattcat ctggcgacgg cggccgtcgt caacgcggcc       360
     tgggatctgt gggccaaagc ggaaggcaag cccgtgtgga agttgctcgt cgacatgagt       420
     cccgaagaac tcgtgcgctg cctcgacttc cgctacgtga ccgacgcgat cacgccgcag       480
     gaagccatcg cgatgttgca tcgtcatgcg aagacacggg gcgagcgcga aaaggaaatg       540
     ctcgcgcagg gctatccggc ctatacgaca tccgcgggct ggctcggcta cgacgacgac       600
     aaaatccgcc ggctcgcgcg tgaaggtgtc gcgcagggct ggacgcactt caagcagaaa       660
     gtgggcggca atctcgacga ggatatgcgc cgcgcccgta ttctgcgcga agaaatcggc       720
     gaagaccgga aactgatgat ggacgcgaac caggtgtggg atgtcgacga agcggtcgcg       780
     aacatgcggc gcctcgcgca attcgatccg tggtggatcg aggagcccac gagtcctgac       840
     gacattctcg gccacgcggc tatccgtcaa cggcttcggc agatcggcgt cgcgaccggc       900
     gagcactgtc ataaccgggt gatgttcaag cagttgctgc aggcgcaggc catcgacttc       960
     tgtcaggtcg atagttgccg gctgggtggt ttgaacgagg tgatcgtcgt tctgctgatg      1020
     gcggcgaaat tcggcgtgcc ggtgtgtccg catgcgggcg gtgtcggatt gtgcgagtac      1080
     gtccagcata tttcgctgtt cgactatatt tgcgtgtcgg cgtcgctaga gaatcgggtg      1140
     ctcgaatacg tggatcatct gcatgagcat ttcgtcgatc cggtcgtgat ccgcaatggc      1200
     cgttatatgc cgccgcagcg ttcgggttac agcatcgaga tgcatgcggc gtcgctcgat      1260
     gaatatgact ttccggaagg ggtggcgtgg agggggtga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page