(data stored in ACNUC7421 zone)

EMBL: CP001053.PE183

CP001053.PE183       Location/Qualifiers
FT   CDS_pept        complement(220027..221211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4176"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ecm:EcSMS35_4680 AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18558"
FT                   /db_xref="GOA:B2TEN7"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN7"
FT                   /protein_id="ACD18558.1"
FT                   /translation="MSRPTGPVRHMVFCRFRADVTPARRLAFFEQIRRLTEVPGIAFTN
FT                   FQCGPNVSPEGYGMNFADGFMMDFESGQPASRISPIRRIRRSARVCSKRSMAARKACSY
FT                   SISIWKLMRNLQGRLDLCSINTATLGHREPLSRTIDRIAKAGFGGIAPWRREVEEADLV
FT                   QIARQIKALDLTVTGYCRSTYLPAATSAEFKANVEANRAALRDAAILGARCFVMVVGGL
FT                   PEGSRDLDGARNQVSEGIEMLLETARDCGVPLALEPLHPVYAADRAVLNTIAQALEICE
FT                   RVDRDRSGMLGVAVDVYHCWWDPALTASIEAAGRAGRILAYHACDWLRETRDVLLDRGM
FT                   MGDGVIDLPAVRQTIESAGYEGLVEVEIFSAQDWWLRDPDEVLAICADRLQNFC"
     atgagccgcc caaccggtcc tgtgcggcac atggtgttct gccggtttcg cgccgacgtc        60
     acgccggcgc ggcggctcgc gttcttcgag cagattcgcc ggctgacgga agtgcccggt       120
     attgccttca cgaactttca gtgcgggccc aacgtatcgc cggaaggcta cggcatgaac       180
     ttcgccgacg gcttcatgat ggacttcgag agcgggcagc ctgcttcgcg tatctcgccc       240
     atccgacgca tcaggcgatc ggcgcgcgtc tgctcgaagc gctcgatggc ggcgcgcaag       300
     gcctgctcgt attcgatatc gatatggaaa cttatgagaa acctgcaagg aagactcgac       360
     ctgtgctcca tcaataccgc gacgctgggg catcgcgagc cgctcagccg cacgattgac       420
     cgcattgcca aagccggatt cggcgggatt gcgccgtggc gtcgcgaagt cgaggaagcc       480
     gatctcgtgc agatcgcaag acagatcaag gcgctcgatc tcaccgtgac cggctactgc       540
     cgctcgactt acttgccggc ggcgacgtcg gcggaattca aggcgaatgt cgaagcgaac       600
     cgcgctgcgt tgcgcgacgc ggccatcctc ggcgcgcgtt gtttcgtgat ggtggtgggt       660
     gggttgcccg aaggcagccg cgatctggac ggcgcgcgaa accaggtctc cgagggcatt       720
     gaaatgttgc tggaaaccgc tcgcgattgc ggcgtgccgc ttgcgctcga accgctgcat       780
     cccgtgtacg cggccgaccg tgccgtgctc aacaccatcg cgcaggcatt ggagatttgc       840
     gagcgcgtgg atagagatcg ctcggggatg ctcggcgttg ccgtcgatgt ctatcattgc       900
     tggtgggatc ctgccctgac ggcttcaatc gaagcagcgg gacgcgctgg gcgaattctt       960
     gcgtatcacg catgtgactg gctgcgcgaa acgcgcgacg tgttgctcga tcggggcatg      1020
     atgggcgatg gcgtcatcga cctgcctgcc gtgcggcaaa ccattgaaag tgccggctac      1080
     gagggtctgg tcgaagtcga aattttctcc gcgcaagact ggtggctgcg cgatccagac      1140
     gaagttctgg caatctgcgc ggaccgcttg cagaacttct gctag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page