(data stored in ACNUC7421 zone)

EMBL: CP001053.PE184

CP001053.PE184       Location/Qualifiers
FT   CDS_pept        complement(221214..222383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4177"
FT                   /product="protein of unknown function DUF993"
FT                   /note="PFAM: protein of unknown function DUF993; KEGG:
FT                   sme:SMc04402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18559"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN8"
FT                   /protein_id="ACD18559.1"
FT                   /translation="MNLSIKLPAASGTMETYRVEGAPLEVRSPARAFNRIAYSAAHVVA
FT                   DPLRAGELNGAPAIDWERTIAYRRYLLQQGLGIAEAMDTAQRGMGLPWSTALELITRSI
FT                   EGTRDIPGAAIASGCGTDHIAPASVTNCDQVIRAYAEQLEAVQRVGGRVILMASRALAR
FT                   VARTPDDYRRVYREVLAMCDQPVILHWLGEMFDPELAGYWGANEFADAAQVCLDIIGTS
FT                   ASKVDGIKISLLDEQKEIAFRQRLPHGVKMYTGDDFNYPALIAGDGMHFSHALLGIFDA
FT                   IAPAASQALSALAANDHASFNALLAPTVPLSRHIFRAPTQYYKTGVVFLAYLNGFQDHF
FT                   FMPGGHHGMRPPAYLADVFRLADQARLLRDPADAVARICRVMAPLGCGD"
     atgaacctgt ctatcaaact tccggccgcg tccggcacga tggaaacata tcgcgtagaa        60
     ggcgcgccgc tcgaggtacg ctcgcccgcg cgcgctttca accgcatcgc gtattccgcg       120
     gcgcacgtgg tagctgatcc gctgcgcgcg ggcgaactga atggcgcgcc cgccatcgac       180
     tgggagcgca cgatcgctta ccggcgctat ctgttgcagc aaggtctcgg catcgccgaa       240
     gcgatggaca ccgcgcagcg cggcatgggc ttgccgtgga gcaccgcgct cgaactgatc       300
     acgcgcagca ttgagggcac gcgcgacatt ccgggcgcgg ccatcgcgtc gggttgcggc       360
     acggaccaca ttgcgcccgc ttcggtcacg aactgcgatc aggtgatccg cgcgtatgcc       420
     gagcaactcg aggcagtgca gcgcgtgggc ggccgcgtga tcctgatggc gagccgcgcg       480
     ctcgcgcggg ttgcgcgcac gccggacgat taccggcgcg tgtatcgcga agtgctcgcc       540
     atgtgcgatc aaccggtgat tctgcattgg ctcggcgaga tgttcgaccc cgaactcgcg       600
     ggctactggg gcgccaatga atttgccgac gcggcgcagg tgtgtctcga cattatcggc       660
     acgagtgcgt ccaaggtcga cggcataaag atctcgctgc tcgacgagca gaaagaaatc       720
     gcgttccgtc agcgcctgcc gcacggcgta aaaatgtaca ccggcgacga cttcaactat       780
     cccgcgctga tcgccggaga cggcatgcat ttctcgcatg ctttgctcgg catcttcgac       840
     gcgattgcgc cggccgcgtc gcaggcattg tccgcgcttg ccgcgaacga tcacgccagt       900
     ttcaacgcct tgctcgcgcc gaccgtgccg ctttcgcgcc acatctttcg cgcgccgacg       960
     cagtactaca agacgggcgt ggtgttcctc gcgtacctga acggcttcca ggatcacttc      1020
     ttcatgcccg gcggccacca tggcatgcgt ccgcccgcct acctcgccga cgtcttccgc      1080
     ctcgccgatc aagcccggct tctgcgtgat cccgcggatg ccgtcgcgcg catctgccgc      1140
     gtcatggcgc ccctcggttg cggagactga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page