(data stored in ACNUC7421 zone)

EMBL: CP001053.PE185

CP001053.PE185       Location/Qualifiers
FT   CDS_pept        complement(222391..223170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4178"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: vei:Veis_0844 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18560"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEN9"
FT                   /protein_id="ACD18560.1"
FT                   /translation="MSARPIALVTGSRRGIGRAIAVELGLAGFDVALTDAAASQELEDA
FT                   VREVERTGARAIALISDLADIDSHTGTLREIEATLDGQIDCLVNNAGVSVMSRGDLLDV
FT                   TPESFDRCIAVNTRGTFFLTQAFAKHCLARSGGAVAPHPSVITITSSNAIAASPLRGEY
FT                   CVSKAGLSMANTLFSLRLAEHGISVYEVQPGLIETEMTAPSRARYDAQIEQGLTAIKRW
FT                   GTPQEVATTVRTLATGGLPYSVGQAIRIDGGLLVTKY"
     atgagtgcgc gtcccattgc tctcgtcacg ggcagccggc gtggcatcgg ccgcgcgatc        60
     gccgtcgaac tcgggcttgc gggcttcgac gtcgcgttga ccgatgcagc ggcatcgcag       120
     gaactcgaag acgccgtgcg cgaggtcgaa cgaaccggtg cgcgtgcaat cgcgctcatc       180
     tcggatctcg ccgacatcga ctcgcacacc ggcactttgc gtgagatcga agccacgctc       240
     gacggccaga tcgattgcct cgtgaacaac gcgggcgtct cggtaatgtc gcgcggcgat       300
     ctgctcgacg tcacgccgga gagtttcgac cgttgtatcg cggtgaatac gcggggcacg       360
     ttcttcctca cgcaggcctt cgcgaaacac tgcctcgcgc gctccggcgg cgctgtcgcg       420
     ccgcatcctt ctgtcatcac aatcacttcg tcgaacgcaa tcgcggcgtc gccgttgcgc       480
     ggcgaatact gcgtgtccaa agccggactt tccatggcga acacgttgtt ctcgctgcgc       540
     ctcgccgaac acggcatcag cgtgtacgaa gtgcagcccg gcctgatcga gaccgaaatg       600
     acggcgccgt cccgcgcgcg ctacgacgcg cagatcgagc aagggctcac cgcgatcaag       660
     cgctggggca caccgcagga agtggcgacc accgtccgca cgcttgcaac gggcgggctt       720
     ccctatagcg tcggccaggc gatccgtatc gacggcggcc tgctcgtcac caaatactga       780
//

If you have problems or comments...

PBIL Back to PBIL home page