(data stored in ACNUC7421 zone)

EMBL: CP001053.PE188

CP001053.PE188       Location/Qualifiers
FT   CDS_pept        complement(226144..226827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4181"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rde:RD1_0515
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4181"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18563"
FT                   /db_xref="GOA:B2TEP2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP2"
FT                   /protein_id="ACD18563.1"
FT                   /translation="MTLASTPPGRALKTAKAGATQPPRQRDPEVTRARILEAAKKEFAK
FT                   LGLAGARVEAIATRAKANKRMIYHYFGSKEELFQAVLEDAYADIRSAELKLNLDHLSPE
FT                   DAIVALTTHTWNYYLKNPEFMTLVNSENLHKARHVKKSERFKELHHGFISMLQRIIDRG
FT                   VEAGVFRAGVDARQLHITMAAVGYYYLTNRFTSGVIFDIDFMSKEALKNRLDFNIETVL
FT                   RLLRP"
     atgactctcg cgagcacgcc ccccggccgg gcattgaaaa cggccaaagc cggcgccacg        60
     caaccgcccc gtcaacgcga ccccgaggtc acccgggccc gcattctcga agccgccaag       120
     aaagagttcg ccaaactcgg cctcgccggc gcacgcgtcg aagccatcgc gacgcgcgcc       180
     aaggctaaca agcggatgat ctatcactac ttcggcagca aggaggagtt gttccaggcc       240
     gtgctcgaag atgcctacgc cgacatccgc tccgccgaac tgaagctgaa cctcgaccac       300
     ctgtctcccg aagacgcgat cgtcgcgctc accacgcaca cgtggaacta ctacctgaag       360
     aaccccgagt tcatgacgct cgtgaacagc gagaaccttc acaaggcgcg ccatgtgaaa       420
     aagtccgaac ggttcaagga actgcatcat ggcttcatct cgatgttgca acgcataatc       480
     gatcgcggcg tcgaagcggg cgtgtttcgc gcgggcgtcg atgcacggca actgcatatc       540
     accatggcgg cggtcggcta ctattacctg accaatcgct tcacgagcgg tgtgatcttc       600
     gacatcgact tcatgagcaa agaggctttg aagaaccgcc tcgacttcaa tatcgaaacc       660
     gttctgcgcc tgctgcgccc ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page