(data stored in ACNUC7421 zone)

EMBL: CP001053.PE194

CP001053.PE194       Location/Qualifiers
FT   CDS_pept        234075..235034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4187"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: transport system permease protein;
FT                   inner-membrane translocator; KEGG: vei:Veis_0888
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18569"
FT                   /db_xref="GOA:B2TEP8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEP8"
FT                   /protein_id="ACD18569.1"
FT                   /translation="MAQMNASLKARLGDNAPFIALIALYLLIEIAQPTFLAPSTQLGLL
FT                   ADSSTLFIMAAGTTFVVLLGSIDLSLQAVASLSSVIVAMLLPRYGAWAAVVALAASFGI
FT                   GLLSGVIQTVLRIPSFIATLAVGGIASAAALTLSGTRSIGISDEMRNASLGWTTGSSFG
FT                   MPHEIMLALVVFLLCVFLHRSTVFGRHVDAIGAGEPAAIASGVRVPVTRCLVFATSSLF
FT                   AGLAGVIMAGRLGSGSPTLADQFLLPAIAAVIVGGTALTGGAGGVGRTLIGALLVSVAR
FT                   VGMTFVGISVFAQQIVFGVILIVAVTVAFDRSKVLIIK"
     atggcacaaa tgaatgcatc actgaaagca cgtctcggcg acaacgcgcc gttcatcgcg        60
     ctcatcgcgc tgtatctgct gatcgagatc gcgcagccca cgttcctcgc gccgtcgacg       120
     cagctcggcc tgcttgctga cagctcgacg ctgttcatca tggcggccgg cacgaccttt       180
     gtcgtgctgc tgggcagtat cgatctgtcg ttgcaggcgg tggcttcgct ttccagtgtg       240
     atcgtggcga tgttgttgcc gcgttacggt gcgtgggccg cggtggtggc gctagcggcg       300
     tcgttcggga ttggactgct gagcggcgtg attcaaaccg tgctgcgcat tccgtcgttc       360
     atcgcgacgc tggcggtcgg cgggatcgcg tcggccgctg cgctgacact gtcggggacg       420
     cgctcgatcg gcatcagcga cgagatgcgc aacgcgtcgc tcggctggac cacgggctct       480
     tcgttcggca tgccgcatga aatcatgctc gcgctggtgg tcttcctgct gtgcgtgttc       540
     ctgcatcgtt cgacggtgtt cgggcggcac gtcgacgcga tcggcgcggg tgaaccggcc       600
     gcgattgcat cgggcgtgcg tgtgccggtg acgcgctgcc tcgtattcgc gacgtcgtcg       660
     ctgtttgccg ggctcgcggg cgtcatcatg gcggggcggt tgggtagcgg atcgccgacg       720
     ctcgccgacc agttcctgtt gcccgctatt gccgcggtga tcgtcggcgg gactgcgttg       780
     acgggcggcg cgggcggcgt cggccggaca ctgattggcg cgctgctggt gtcggtcgcg       840
     cgggtcggta tgacgtttgt cgggatcagt gtgtttgcgc agcagatcgt gttcggcgtg       900
     attctgatcg tcgcggtgac ggtggcgttc gatcgctcga aagtgttgat catcaagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page