(data stored in ACNUC7421 zone)

EMBL: CP001053.PE196

CP001053.PE196       Location/Qualifiers
FT   CDS_pept        235852..236784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4189"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: bxe:Bxe_A0999 electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18571"
FT                   /db_xref="GOA:B2TEQ0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ0"
FT                   /protein_id="ACD18571.1"
FT                   /translation="MTNLVIAEHDNASIKAATLNTVAAAQKIGGDIHVLVAGHNAQAAA
FT                   DAAAKIAGVSKVLLADAPQLEAGLAENVEATVLNIAKDYTHILAPATAYGKNITPRIAA
FT                   KLDVAQISDITAVDSADTFERPIYAGNAIATVQSADPIKVITVRTTGFDAVAAEGGSAT
FT                   VEKIEAAADSGISSFVSREVTKLDRPELTSAKVIVSGGRGLGNGENYTKVLEPLADKLN
FT                   AALGASRAAVDAGFVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINK
FT                   DEEAPIFSVADYGLVGDLFDAVPDLTTSV"
     atgacgaatc ttgtaatagc agaacacgac aacgcgtcga tcaaggccgc gacgctgaac        60
     acggttgccg ccgcgcagaa gattggcggc gatattcacg tgctggtggc gggtcacaac       120
     gcgcaagccg cggcggatgc ggcagcaaag attgcaggcg ttagcaaagt gctgctggcc       180
     gacgcgccgc aactcgaagc aggcctcgcg gaaaacgtcg aagcaacggt gctgaatatc       240
     gcgaaggatt acacgcatat cctcgcgccg gcgacggctt acggcaagaa catcacgccg       300
     cgtatcgcag cgaagctcga cgttgcgcag atcagcgata tcacggcagt ggattcggct       360
     gatacctttg aacgtccgat ctacgccggc aacgcaatcg caacggtgca gtcggctgat       420
     ccgatcaagg tcatcacggt tcgcacgacc ggtttcgatg cagtcgcagc cgaaggcggc       480
     agcgcgacgg tcgagaaaat cgaagcggca gcggacagcg gcatctcgtc attcgtgagc       540
     cgcgaagtga cgaagctgga ccgtccggaa ctgacctcag cgaaggtgat cgtctcgggt       600
     ggccgcggtc tcggcaacgg cgagaactac accaaggttc tcgaaccgct ggcggacaaa       660
     ctgaacgccg cgctcggcgc ttcgcgtgcc gcagtcgacg caggcttcgt accgaacgac       720
     tatcaagtgg gccagaccgg caagatcgtc gcaccgcagc tgtatatcgc agtcggcatc       780
     tcgggcgcga tccagcatct ggccggcatg aaagacagca aggtgatcgt cgcgattaat       840
     aaagacgaag aagcgccgat tttcagcgtc gccgattacg gcctcgtcgg cgatcttttc       900
     gacgcggtcc cggacctgac cacgtcggtc taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page