(data stored in ACNUC7421 zone)

EMBL: CP001053.PE2

CP001053.PE2         Location/Qualifiers
FT   CDS_pept        complement(663..947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3991"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18377"
FT                   /db_xref="UniProtKB/TrEMBL:B2TAL8"
FT                   /protein_id="ACD18377.1"
FT                   /translation="MSSLMIRDLSGTRELDRRAMSAVAGGTGSSVPGLPSVAGLGGIAN
FT                   VNVSINQNLNQMQYVNVAALNNVGVIGAGFVPLHLNVSPSLWGANNATV"
     atgtcatccc tcatgattcg cgatctgtcc ggcacccgcg agctcgaccg ccgcgccatg        60
     tcggcggtgg ccggcggcac cggcagcagc gtgcccggcc tgccctcggt cgccggcctt       120
     ggcggcattg ccaacgtcaa cgtctcgatc aaccagaacc tcaaccagat gcagtacgtc       180
     aacgtcgccg cactcaacaa cgtcggcgtg atcggcgcgg gcttcgtgcc gctgcacctg       240
     aacgtcagcc cgtcgctgtg gggcgccaac aacgccaccg tgtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page