(data stored in ACNUC7421 zone)

EMBL: CP001053.PE201

CP001053.PE201       Location/Qualifiers
FT   CDS_pept        241250..242158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4194"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3473 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18576"
FT                   /db_xref="GOA:B2TEQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ5"
FT                   /protein_id="ACD18576.1"
FT                   /translation="MKRALPPLNALRAFEAAGRLGSFKEAAAELHVTHGAVSQHVRALE
FT                   EWLGASLFERHNRRVALTTAAKTYLAEIGPLFEELARATARYGFPDTLSRTLSVNAPAT
FT                   FTLRWLVPRLATFRAAHPDVNVNVQTSNESLESLKETYDVIVRGGPDTFYGYSMRPFLS
FT                   EERIPVCSPALLQRLPLRTPDDMRQHTLLHTSSLPRVWPDWLASAEIPALRPAAALSFD
FT                   HFFLTLQAAIDGIGIAMGPTALVADDLASGRLVAPFAGPRLPSRSYCTYVPDAKSADEL
FT                   VLLFRAWLEREAMHSQAQTAL"
     atgaaacggg ccctgccacc gctcaatgcc ttgcgcgcct tcgaagccgc gggccgtctc        60
     ggcagcttca aggaagccgc cgctgaatta cacgtgactc acggtgcggt aagccagcac       120
     gtgcgtgcgc tcgaagagtg gctcggcgca tcgttgttcg aacggcacaa ccggcgcgtc       180
     gcgctgacga cggcagctaa gacttatctg gcggaaatcg gtcctttgtt cgaggaactc       240
     gcacgggcca cggcccgata cggattccct gacacgcttt cccggacact atccgtgaac       300
     gcgcccgcga ccttcacatt gcgctggctg gtgccgagac tggcgacatt ccgcgccgcg       360
     catcccgatg tgaacgtcaa tgtgcagacg tcgaacgagt cgttggagag tctgaaggag       420
     acctacgacg tgatcgtccg gggcggtccg gacaccttct atggctactc gatgcggcca       480
     ttcctgtccg aggagcgaat tcccgtttgt agtccggcgc tgttgcagcg cctgccgctt       540
     cgaacgccgg acgatatgcg gcagcacacg ttgctgcata cgtcgagtct gccgcgggtt       600
     tggccggact ggctggccag cgcggagatt ccggcactca ggccagccgc cgcgctgagc       660
     ttcgatcact tctttctgac gttgcaagcg gccatcgacg gaataggcat tgcgatggga       720
     ccgaccgccc tggtcgccga cgatctcgcg tccggccggc ttgtcgcgcc gttcgccggt       780
     cctcgtttgc cgtcgcggag ctattgcact tacgttccgg atgcgaagtc ggcggacgaa       840
     ctggtcctgc tgttccgcgc atggctcgaa cgcgaagcta tgcactcaca ggcgcagacg       900
     gccctttag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page