(data stored in ACNUC7421 zone)

EMBL: CP001053.PE204

CP001053.PE204       Location/Qualifiers
FT   CDS_pept        complement(243740..244396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18579"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEQ8"
FT                   /protein_id="ACD18579.1"
FT                   /translation="MPCRCLRSTCWHFFGCRCQAAALLRCMVFTSNFDVQENSGKDSTA
FT                   VWRWRREAAGRQVRAGTYSPTEPRRLLRSDSALQTDVRSGIATNAASSRFRSSGRLDSP
FT                   VIFPANFRFRIRPLPDSTDAARTVPHATRSTGTRPGKFGRPTSQKRRRPRQQPRPNRTA
FT                   ACRCSRIVSRADLSVICIWTDYDSDGRHRIYRLRWLGERLWPVSLNHSASWTTRS"
     atgccttgtc gttgcttgcg tagcacatgc tggcattttt tcggctgtcg ctgccaagca        60
     gcggctctac tccgctgcat ggtgttcacg tcgaacttcg acgttcaaga aaacagcggt       120
     aaagattcaa ctgccgtttg gcgctggcgc cgcgaagccg ctggtcggca ggttcgtgca       180
     ggaacgtatt cgccgacgga gccgaggcgc ttgttgagat ccgacagtgc tttgcagacg       240
     gacgtgcgat cgggcattgc gaccaatgcc gcctcgagcc ggttcagaag ttccggcaga       300
     ctcgattccc cagtcatctt tcctgcgaac ttccgcttcc gcataagacc gctccctgat       360
     tcgacagacg ctgcgcgcac agtgcctcat gctaccaggt cgacagggac gcgtccaggc       420
     aagttcggga gaccgacctc gcaaaagcgg agacgtccta ggcaacaacc gaggccgaat       480
     agaacagcgg cctgccgatg ttcgcgaata gtttcccgcg ctgacttgtc cgtcatttgc       540
     atctggaccg attatgatag cgacggacga catcgtattt atcgcctgag gtggctcggg       600
     gaacggctgt ggcccgtctc gctgaatcac tccgcaagct ggacaaccag gtcatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page