(data stored in ACNUC7421 zone)

EMBL: CP001053.PE206

CP001053.PE206       Location/Qualifiers
FT   CDS_pept        245467..245748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18581"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER0"
FT                   /protein_id="ACD18581.1"
FT                   /translation="MYVRSIAAVLVASIALLTDPAFAGGDDQTSSYRNDVATSVAHRGQ
FT                   TAQAKAAAEGHGGVVDVNHSGVGGSESGKSQSGRRAPGDSINPMYHGG"
     atgtacgtga gatctattgc cgctgtgtta gtcgcaagca tcgcattgct aacagatccc        60
     gcattcgcgg gtggtgacga ccagacgtcc tcctatcgaa acgacgtcgc tacgtcagta       120
     gcgcatcgcg gtcaaaccgc tcaggcgaag gcggcggcag aaggccacgg tggcgtggtt       180
     gacgtgaacc atagcggcgt tggcggtagc gaatcgggta agtcgcaatc cggtcggcgt       240
     gccccgggcg atagcatcaa tccgatgtat cacggtggtt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page