(data stored in ACNUC7421 zone)

EMBL: CP001053.PE208

CP001053.PE208       Location/Qualifiers
FT   CDS_pept        246679..247119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4201"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: bxe:Bxe_C1219
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18583"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER2"
FT                   /protein_id="ACD18583.1"
FT                   /translation="MRRVIVRRSSVHGKGVFAMRPLAAGECVLEYRGELTSWREAVRRH
FT                   RREGVAGHTFLFGLSDGRVIDGSRGGNSARWLNHACAPNCETVEDDGRIFIHTIRPIEA
FT                   GEELFIEYLLATDDPLDEDVRAQYACRCAVVGCRRSMLAAVT"
     atgcggcgcg tgatcgtacg gcggtcgtca gtccacggaa agggtgtgtt cgcgatgcgg        60
     ccgctcgcgg cgggcgagtg cgtgcttgaa taccggggcg aattgacgag ctggcgggaa       120
     gccgtgcgcc ggcatcggcg cgaaggcgtc gccgggcaca cgtttctttt tggcctgtcg       180
     gacggacgcg tgattgacgg aagccgtggc ggcaatagtg cgcgatggct gaaccacgca       240
     tgcgcgccga actgcgaaac cgtcgaggac gatggccgaa tcttcattca cacgatccgg       300
     ccgatcgagg caggcgaaga actgtttatc gaatacctgc tggcgaccga cgatcccttg       360
     gacgaggacg ttcgagcaca atacgcttgc cggtgtgccg tggtgggctg tcgtcggtcg       420
     atgctggcag ccgtcacttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page