(data stored in ACNUC7421 zone)

EMBL: CP001053.PE215

CP001053.PE215       Location/Qualifiers
FT   CDS_pept        complement(255446..255994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4209"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bxe:Bxe_C1223 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18590"
FT                   /db_xref="GOA:B2TER9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2TER9"
FT                   /protein_id="ACD18590.1"
FT                   /translation="MMQQTASKTPQQSADPDAVRTTRQPSANATMPVELTVNGNLYTLS
FT                   LDPRTTLLDALREHLHLTGTKKGCDHGQCGACTVHVNGRRVNACLLLACAHAGDEITTI
FT                   EGIGQPEALHPMQAAFVECDGYQCGYCTSGQIMSAVALLGEAVGPDDAEVREAMSGNLC
FT                   RCGAYQNIVAAIQRVRGQS"
     atgatgcaac agaccgcctc caaaaccccg caacaaagcg ccgaccccga cgcggttcgg        60
     accacccgtc agccttccgc gaacgcgacg atgccagtcg agttgaccgt caacggcaat       120
     ctctacacgc tgtcgctcga tccgcgcacc acgctgctag atgcgctgcg cgagcatctg       180
     cacctcaccg gcaccaaaaa gggttgcgac cacggccaat gcggcgcgtg cacagtgcac       240
     gtgaacggac ggcgcgtgaa tgcgtgcctg ttgctcgcct gcgcgcacgc cggcgacgaa       300
     atcaccacca tcgaaggcat cggtcagcct gaagcgctgc atccgatgca agccgcgttt       360
     gtagaatgcg acggctatca gtgcggctac tgcacgtcgg gccagatcat gtccgcggtc       420
     gccctgctcg gtgaagcggt cgggccggac gacgccgaag tgcgcgaagc gatgagcggc       480
     aatctgtgcc gctgtggcgc ctatcagaac atcgtcgcgg cgatccagcg cgtgcgcggc       540
     caatcctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page