(data stored in ACNUC7421 zone)

EMBL: CP001053.PE216

CP001053.PE216       Location/Qualifiers
FT   CDS_pept        complement(256392..257069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4210"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sme:SMb20212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18591"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES0"
FT                   /protein_id="ACD18591.1"
FT                   /translation="MKILLVLTSHNVLGDTGKPTGFWLEEFTAPYYAFTDAGAEVTVAS
FT                   PKGGQPPIDPKSDDPDNQTDTMLRFKKDPATQKALANSVKLADVKAADYDTIFYAGGHG
FT                   PMWDLTNDKNSIALIEDFYNAGKPVAAVCHGPCVLFKATYEGQPLVKGKRVTGFTNDEE
FT                   EAVGLTKVVPFLVEDELKRLGGHFEKVENWAVLTVVDGRLITGQNPASSGPTAKELLKV
FT                   LQA"
     atgaaaattc tgttggtttt gacttcgcac aacgtgctcg gcgatacagg caagccgacc        60
     ggcttctggc tcgaagaatt caccgcgccc tactatgcgt tcacggatgc cggtgcggag       120
     gtcaccgtgg cctcacccaa gggcggccaa ccaccaatcg atcccaaaag cgacgatcca       180
     gacaatcaga ccgacaccat gctgcgcttc aagaaagatc ctgcgaccca gaaggcgttg       240
     gccaacagcg tcaagctcgc cgacgtcaag gccgccgact acgacacgat cttctatgcc       300
     ggcggccacg gcccaatgtg ggatctgacc aacgacaaga actcgattgc gctgatcgag       360
     gatttctaca atgcgggcaa gccggtcgcc gctgtctgtc atggtccgtg tgttctgttc       420
     aaggcgacct acgagggaca gcctctcgtc aagggaaagc gcgttaccgg ctttaccaac       480
     gacgaagaag aagccgtggg cctcaccaag gttgtgccct ttctcgtcga ggacgagctc       540
     aagcgtctgg gcggccactt tgagaaggtg gagaactggg ccgtgctcac ggttgtcgat       600
     ggacggctga tcaccggcca gaatccggcc tcctccgggc cgactgccaa agagttgctg       660
     aaggttctgc aggcctag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page