(data stored in ACNUC7421 zone)

EMBL: CP001053.PE218

CP001053.PE218       Location/Qualifiers
FT   CDS_pept        complement(257979..258413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4212"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: bam:Bamb_4525
FT                   DGPFAETKE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18593"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES2"
FT                   /protein_id="ACD18593.1"
FT                   /translation="MRVMVMVKATAESEAGQMPGTELIEAMGRYNEELVKAGIMLGGDG
FT                   LKPSSKGVRVKFSGKDRTVVDGPFAETKELIAGYWIWQVQSMEEAIEWVRRCPNPMASD
FT                   SEIEIRPFFEAADFGEAFTPELQEHEERLRQQIESKQSKD"
     atgcgcgtta tggtcatggt caaggcgacc gctgaatccg aagccggtca aatgcccggc        60
     acggaactta tcgaagcgat gggccgatat aacgaggagc tggtcaaggc cggcatcatg       120
     ctcggcggcg acggacttaa accgagctcg aaaggcgtgc gcgtgaaatt ttctggcaag       180
     gatcgaaccg tcgtcgacgg tccgtttgcc gaaaccaagg aattgatcgc gggctactgg       240
     atctggcaag tgcaatcaat ggaagaagcg atcgaatggg tacgccgctg cccgaacccg       300
     atggcgagcg attcggaaat cgaaattcgc ccgttcttcg aggctgcgga ttttggcgag       360
     gcatttacgc ctgagctaca ggaacacgaa gagcggcttc ggcagcagat tgaatcgaag       420
     caaagtaaag actaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page