(data stored in ACNUC7421 zone)

EMBL: CP001053.PE223

CP001053.PE223       Location/Qualifiers
FT   CDS_pept        262759..263721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4217"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bam:Bamb_6378 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18598"
FT                   /db_xref="GOA:B2TES7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TES7"
FT                   /protein_id="ACD18598.1"
FT                   /translation="MSENNRTRLLIARKVPTAVANRAEAEFHAFVTESDMDAWSVVDFC
FT                   KKHATPAVLIGKKSGLQAEHIAALPSTVKIIANASAGFDHMDVAAARERGIVVTNAPDA
FT                   LTECTADFSLLLVLAACRRASEYERIMRNGWGKSFGMTEMLGTRVNGKTLGIVGFGRIG
FT                   RAVAKRAQGFGMRVIYTDINRAAASLENGATFYNSLDEMLPHCQVLTLHVPGGGVPLMT
FT                   KREFALLPAGAVFVNAARGALVDEDALYEALTSGHLFGAGLDVYRNEPNVDKRFAGLDN
FT                   VFLTPHMASATMETRDQMGFTALDNVAAVLNERPALNPV"
     atgtcggaaa ataaccgcac caggctgttg attgcgcgaa aggtgcccac agccgtggcg        60
     aatcgcgccg aggccgaatt tcatgccttc gtgaccgagt ccgatatgga cgcgtggtcg       120
     gtcgtcgact tttgcaaaaa gcacgcaacg ccggccgtat tgatcgggaa gaagtcgggt       180
     ctgcaagcgg agcacattgc cgcgctgccc tcgacggtga aaatcattgc gaacgcgagc       240
     gcgggtttcg atcacatgga tgtggcggcc gcccgcgaga ggggaatcgt cgtcacgaac       300
     gcacccgatg cgttgaccga atgcacggcc gacttttccc ttctgctcgt gctggcggct       360
     tgccgccgcg cgtcggaata tgaacggatc atgcgcaacg gttggggcaa atcattcggg       420
     atgaccgaga tgctgggtac gcgcgtcaat ggcaagacgc tcggcattgt cggattcggg       480
     cgtatcgggc gcgcggtcgc gaagcgtgcg cagggcttcg gcatgcgcgt gatctatacg       540
     gacatcaacc gtgcggctgc gtcgctggaa aatggcgcga cgttttacaa cagcctcgac       600
     gaaatgttgc cgcactgcca ggtgttgacg ctgcacgtgc cgggcggagg cgttccgcta       660
     atgacaaaaa gagaatttgc gctcctgccg gcgggcgcgg tttttgtcaa cgcggcgcgt       720
     ggcgcactgg tggatgaaga cgcgctctac gaagcgctga cctcgggaca tctgtttggt       780
     gcaggtctgg acgtgtaccg gaacgagccc aatgtcgata agcggttcgc cggactcgac       840
     aacgtgttcc tgacgcctca catggccagc gccacgatgg agacgcgcga tcagatgggt       900
     tttacggcgc tggataatgt tgccgctgtg ctgaatgaac ggcctgcatt gaacccggtc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page