(data stored in ACNUC7421 zone)

EMBL: CP001053.PE228

CP001053.PE228       Location/Qualifiers
FT   CDS_pept        complement(266288..266614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18603"
FT                   /db_xref="GOA:B2TET2"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET2"
FT                   /protein_id="ACD18603.1"
FT                   /translation="MDEQKRLSMIAYLRRKMTTVGIKVADLKAAIAEDRARQKSARYRS
FT                   AFGDTWDGKGDMPQWLKQATSAGQSLTHFAIDKPSASASRQRPAIDWSRDPFAGTRLAT
FT                   VRAS"
     atggacgagc aaaaacgcct cagcatgatt gcgtacctgc gccgcaagat gaccacagtc        60
     ggcatcaagg tggcggacct caaagcggcg atcgccgaag acagggcgcg ccaaaagtcg       120
     gcgcgatatc gcagtgcttt cggcgacacc tgggacggca agggcgatat gccgcaatgg       180
     ctaaaacaag ccacgagcgc cggacaatca ctgacgcact ttgcgatcga caaaccgtcg       240
     gcatcggcta gccgtcaacg tcctgccatc gactggagtc gagacccgtt cgcgggcacg       300
     cgtctggcga cagttcgggc ttcttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page