(data stored in ACNUC7421 zone)

EMBL: CP001053.PE229

CP001053.PE229       Location/Qualifiers
FT   CDS_pept        267165..267416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4223"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18604"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET3"
FT                   /protein_id="ACD18604.1"
FT                   /translation="MKLRLMVASAFGLFVMAGFAYAQSMPDAAQPAPQQSAATQADSSP
FT                   STGMEAYGGTPDTRMQSGARHARPCRVDPQCNVFFGGS"
     atgaaattac gattgatggt tgcttctgct ttcgggttgt ttgtcatggc cgggtttgca        60
     tatgcgcaaa gcatgcccga tgctgcacaa cccgctccgc agcaaagcgc cgcgactcag       120
     gctgattctt cgcccagtac ggggatggaa gcctacggcg gcacgcctga tacccggatg       180
     caaagcggcg cgcgccatgc caggccgtgc agggtagacc cgcaatgcaa cgtttttttc       240
     ggaggcagct aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page