(data stored in ACNUC7421 zone)

EMBL: CP001053.PE23

CP001053.PE23        Location/Qualifiers
FT   CDS_pept        24912..25676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4012"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bch:Bcen2424_5466 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18398"
FT                   /db_xref="GOA:B2TE77"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE77"
FT                   /protein_id="ACD18398.1"
FT                   /translation="MPTPADKSNTKESEGVAVIDRACAILFAFRPDDYALTLAELAART
FT                   GLYKSTLLRLAGSLIQHRLLLRLDDGRYQLGSATFMLGALYQRSLNLGDIVVPLMRELA
FT                   ETSGESVSFYVRDEAVRVCLHRVDSRHAVRFHVREGDVLPLESGSGGLALLAFGGMPGA
FT                   PYEKIREDFYCVSIGERDRETAGISMPVFGVRQSLRGVLTLAGPSSRIDQAFLERNLGA
FT                   LFDCAARATDALGGDSRAMRNAQRRAAEVQDK"
     atgccaacgc ccgcggacaa atcgaacacg aaggaaagcg aaggtgttgc cgtcatcgat        60
     cgtgcttgcg ccatcctgtt cgccttccgg ccggacgatt acgcgctcac gctcgccgaa       120
     ctggcggcgc gcacggggct ttacaagagc acgttgttgc ggctcgcggg ctcgttgatc       180
     cagcatcgcc tgctgctgcg tctcgacgac ggccgctatc agctcggctc cgccaccttc       240
     atgctgggcg cgttgtacca acgcagcctg aacctcggcg atattgtcgt gccgctcatg       300
     cgcgagctcg cggaaaccag cggcgaaagc gtgtcgttct acgtgcgtga cgaggcggtg       360
     cgggtgtgtc tgcatcgggt ggattcgagg catgcggtgc gttttcacgt gcgcgaaggc       420
     gacgtgctgc cgctggaaag cggctcgggc ggccttgcat tgctcgcgtt cggcggcatg       480
     ccgggcgcgc cgtacgagaa gattcgcgag gacttctact gtgtgtcgat cggcgaacgc       540
     gaccgggaga cggcgggtat ttccatgccg gtattcggcg tgcggcagag cctgcgtggc       600
     gtgctgacgc tggccggccc gagctcgcgt atcgaccagg cgtttctcga acgcaatctc       660
     ggcgcgctat tcgattgcgc ggcacgcgcc accgacgcct tgggtggcga ttcgcgcgcc       720
     atgcgcaacg cgcagcggcg tgcggccgaa gttcaggaca agtag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page