(data stored in ACNUC7421 zone)

EMBL: CP001053.PE230

CP001053.PE230       Location/Qualifiers
FT   CDS_pept        complement(267662..268183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18605"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET4"
FT                   /protein_id="ACD18605.1"
FT                   /translation="MDDRFDRRELLLHLGDILAALNCLNDANEPGASVAHLVKKHASLE
FT                   HFAFLHALSPTMTTSEFGTRVARSFFSWPSELLEADLNRDTLASTVQQNLFEANPDGWN
FT                   AYLGYVRKKVKWFGTALSNHGKDALAEPSHDVPNETSPIEPPVKVEPTAQADARDEKRG
FT                   WPWPEPRSKS"
     atggacgatc gatttgatcg acgagaactg ctccttcacc tgggcgacat tctcgccgcg        60
     ttgaactgtt taaacgacgc gaacgaaccg ggcgcctcgg tggcgcatct tgtgaagaaa       120
     catgcttcat tggagcactt cgcgttcctt cacgccctgt cgccaacaat gacgacgagc       180
     gaattcggca cacgcgtcgc ccgttcattt ttctcgtggc caagcgagtt gctcgaggcg       240
     gatctcaatc gggacacact cgcgtcaacc gtccaacaga atctgtttga agcaaatccc       300
     gacggctgga acgcgtatct cggctacgtc cgaaagaaag tgaagtggtt cggcaccgca       360
     ctctcgaatc acggcaaaga cgctctggct gaaccgtcgc acgatgtccc caatgagacc       420
     agcccaatcg agccgccggt caaggtcgag ccgactgcgc aagcggatgc gcgcgacgag       480
     aaaagaggtt ggccctggcc ggaaccgcgg tcgaagtcct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page