(data stored in ACNUC7421 zone)

EMBL: CP001053.PE235

CP001053.PE235       Location/Qualifiers
FT   CDS_pept        complement(271815..273062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4229"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_A2589 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18610"
FT                   /db_xref="GOA:B2TET9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2TET9"
FT                   /protein_id="ACD18610.1"
FT                   /translation="MRILIIGAGVIGLSSAYYLSRAGYDVTVADRHAEVASETSFGNGG
FT                   QLSYSYVAPLAGPGVVSKLPRWLTQRDSPVRFRPKLSVEQWRWCFEFLSACTRARSELT
FT                   TQKLLSLSFLSRTLMHELIAAEPSLDFDFVRSGKLVLHRDANAMQSAVDLLAFQRTLGC
FT                   EQQALSADACVEIEPALAHARSFLAGGIHTPSEDTADCRRFCKGLEAVLRERGVRFLMN
FT                   TPIDGLKFGAKGVEAICDGAPLAADRIVVASGAGAAQLLKPLGIRVAIYPIKGYSLTFD
FT                   LQPHITAPHVSITDFARKVVYARLGERLRVGGIADIGGYSLDADPARFATLRKETATLF
FT                   PEVAQSAASGEWTGLRPATPHGLPIVGPTRYPNLWLNVGHGALGFTLATGSAALLADGL
FT                   AGSNNRELSSAFVLSH"
     atgcggatat tgatcatcgg cgcgggcgtc atcggcctgt cgagcgcgta ttacctgagc        60
     cgcgcgggct atgacgtcac ggtagcggac cggcatgcgg aggtcgccag cgaaaccagt       120
     ttcggcaacg gcgggcagct gtcgtatagc tacgtcgcgc cacttgccgg ccccggcgtc       180
     gtgtcgaaac tgccgcgctg gctaacgcag cgcgattcgc cggtacgttt ccggccgaag       240
     ctgagcgtcg aacagtggcg ctggtgcttc gaattcctgt ccgcctgcac acgcgcccgc       300
     agcgagttga ccacgcaaaa gctgctgtca ctgtcgttcc tgagccgcac gttgatgcac       360
     gaactcatcg ccgccgaacc ctcgctcgat ttcgacttcg tgcgctccgg caagctcgtg       420
     ctgcatcgcg acgccaacgc catgcaaagc gcggtggatt tgctggcgtt ccagcgcacg       480
     ctcggttgtg aacagcaggc gctgagcgcc gacgcatgcg tggaaatcga gccggcgctt       540
     gcgcatgccc ggtcgtttct ggcgggcggc attcatacgc cgagcgaaga cacggccgat       600
     tgccggcgct tctgcaaggg tctggaggcg gtgctgcgcg agcgcggcgt acgcttcttg       660
     atgaacacgc caatcgatgg cctcaagttc ggtgcaaaag gcgtcgaagc catttgcgat       720
     ggcgcaccgc tcgcggcgga tcggattgtc gtcgcctcgg gtgcgggcgc agcgcaattg       780
     ctcaagccgc tcggcatccg cgtggcgatc tatccgatca agggctatag cctgacattc       840
     gatcttcagc cgcacatcac ggcgccgcat gtgagcatca ccgacttcgc ccgtaaggtc       900
     gtctatgcgc ggctgggcga acggctgcga gttgggggca ttgccgatat cggcggctat       960
     tcgctcgatg cagaccccgc gcgcttcgcg acgctgcgca aggagacggc tacgctgttt      1020
     cccgaggtcg cccaatccgc cgcttctggc gaatggaccg gtttgcgtcc ggcaacgccg      1080
     cacggcctgc cgattgtcgg accgacgcgc tatccgaacc tgtggctcaa cgtaggacat      1140
     ggcgcgctcg gctttacgct cgcgacgggt tcagccgcgc tattggcgga tggactcgcg      1200
     ggcagcaaca atcgcgaact gagcagcgcc ttcgtccttt cgcattga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page