(data stored in ACNUC7421 zone)

EMBL: CP001053.PE237

CP001053.PE237       Location/Qualifiers
FT   CDS_pept        274599..275753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4231"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A4327 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18612"
FT                   /db_xref="GOA:B2TEU1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU1"
FT                   /protein_id="ACD18612.1"
FT                   /translation="MSKSTALGRGMATVGILGTLAAAAVGAARADEMVKIGEAAPVTGP
FT                   ASYLGKDTENGARLAIEEINQKGLVIGGQKVTLVFDAQDDAGDPRQATQVAQKLVDDKV
FT                   VAVVGHMQSGSTIPASKIYNDAGVVQVSPSATNPAYTLQGFKTAYRVVATDAQQGPTLA
FT                   DYAAKTLKVKTVAIVDDSTAYGQGLAVEFERQAKANGVTVLSHDASTDKAVDFRAILTK
FT                   IKGEKPDAIMYGGLDGTGGPFAKQAKQLGITIKVLAGDGLCADDLAKLAGDAADNVICS
FT                   IAGAPLLKMAEGPAFVERYKKRFGYAPVLNSPFAYDAVGVIVAAMKRAQSTDSAKILAA
FT                   MPATDYHGVLGETQFDSRGDLRHGVISLYKYVGGKQALLGVVEK"
     atgagcaaaa gcacagcctt gggtcgcggc atggcgactg tcggcattct gggtacattg        60
     gcggcggctg ccgtgggcgc cgcccgtgcc gacgagatgg tgaaaatcgg cgaagccgcg       120
     cccgtgaccg ggccggcttc gtatctgggc aaggacacgg aaaacggcgc gcgccttgcg       180
     atcgaggaaa tcaaccagaa ggggctcgtg atcggcggac agaaggtgac gctggtgttc       240
     gacgcccagg acgatgccgg cgatccgcgt caggcgaccc aggtcgcgca gaaactggtg       300
     gacgacaaag tggtcgcggt ggtcggccat atgcagtccg gttcgaccat tcccgcgtcg       360
     aagatttaca acgatgccgg tgtcgtgcag gtgtcaccgt ccgcgaccaa cccggcgtac       420
     acgttgcagg gattcaagac cgcgtatcgc gtggtcgcca ccgacgcaca gcagggaccc       480
     acgctcgccg attacgccgc aaaaacgctg aaggtgaaga cggtggcgat cgtcgacgat       540
     tcgaccgcct acggccaggg cctagcggtc gagttcgaga ggcaggcgaa ggcgaatggc       600
     gtcacggtgt tgtcgcacga cgcgagcacc gacaaggccg tcgacttccg cgcgattctc       660
     acgaagatca agggcgaaaa gccggacgcg atcatgtacg gtggcctcga cggcaccggc       720
     ggaccgtttg cgaagcaggc aaagcagctc ggcatcacga tcaaagtgct cgccggcgac       780
     ggcttgtgcg ccgacgacct cgcgaaactc gcgggcgacg ccgccgataa cgtgatctgc       840
     tcgattgccg gtgcgccgct gctcaagatg gccgaaggtc cggcgtttgt cgaacgctac       900
     aagaagcgtt tcggctatgc gccggtcttg aattctccgt ttgcatacga tgcggtcggg       960
     gtgatcgttg cagcgatgaa gcgcgcgcag tcgacggact ccgcgaagat tctcgcggcg      1020
     atgccggcga ccgattatca cggcgtgctc ggcgaaacgc agttcgattc cagaggcgac      1080
     ctgcggcacg gcgtgatctc gctgtacaag tatgtcggtg gcaaacaggc gttattgggc      1140
     gtggtggaga agtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page