(data stored in ACNUC7421 zone)

EMBL: CP001053.PE238

CP001053.PE238       Location/Qualifiers
FT   CDS_pept        276083..276619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4232"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: bxe:Bxe_B2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4232"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18613"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU2"
FT                   /protein_id="ACD18613.1"
FT                   /translation="METTKQDKTETGSGAPDALAFLEAEHRAVEKLFTAFEKAADDDLE
FT                   AKSALAQRACEELSIHTMLEEELLYPAAQEALPDSDAIDVEEAYIEHFLVKTLIAKFET
FT                   MKAGDKGFDATFKVMSEMVGHHVEEEEEELFPELRKTPCDLRALGEKMAKRKAELQGKL
FT                   DAAGSKLVGDKTLAG"
     atggaaacca ccaagcagga caaaacggaa acgggctcgg gcgcgcccga tgcactggct        60
     tttctcgagg cggagcatcg cgcagtggag aaacttttca cggcattcga gaaagcggcc       120
     gacgacgatc ttgaggcgaa gtcggcactg gcgcagcgtg cctgcgaaga gctttccatt       180
     catacgatgc tcgaagagga actgctttat ccggccgcac aggaagcatt accggacagc       240
     gacgcgatag acgtcgagga agcgtatatc gaacatttcc tcgtcaagac cttgatcgcc       300
     aaatttgaaa ccatgaaggc gggtgacaag ggcttcgatg cgaccttcaa agtgatgagc       360
     gagatggtgg gtcatcatgt cgaggaagaa gaagaggaac tctttccgga gctgcgcaag       420
     actccttgcg atctccgcgc actcggtgaa aaaatggcga agcgaaaggc cgaactgcag       480
     ggtaagctcg acgcggcagg tagcaaactg gtgggcgaca agacactcgc cggctaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page