(data stored in ACNUC7421 zone)

EMBL: CP001053.PE240

CP001053.PE240       Location/Qualifiers
FT   CDS_pept        279424..280617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4234"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psp:PSPPH_1052 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18615"
FT                   /db_xref="GOA:B2TEU7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU7"
FT                   /protein_id="ACD18615.1"
FT                   /translation="MTNTVPSNQTEVRMPDSALDGESSTSFASLEATPTPRRACRTSLL
FT                   ARRYALELRQETPRRKQAVVLAFSVTVGLAVCVAILMTAGISASDLFNEFIVETLGDAD
FT                   NFRAVLFQAAPMVMVGLAAALSFRAKFWNLGLEGQMVWGAIGATAVALADAGTPETRLW
FT                   LMGAAALVCGALWTVLPLLLRMRLGISEIISTLMLNYVAANLLLNLVYGQWKDPRDSFP
FT                   HSRNFLAAERLPSIASGYSSAILLAVLFALAAWWFLHRSRAGIYVRFVNVNARAAEAMG
FT                   VPVRNVVAGVVLLSGALAGFAGFTVTAAQAGRLTQDFYSGYGFSGILIAFLARNNPIAA
FT                   SVVALLVAALFVTGRSLQVLYQIPFSMVQLIQAILVIVVAASDFFTRYRLSPVGVAE"
     atgaccaata ccgtaccgtc caaccagacg gaggtccgca tgccagactc cgcgctcgac        60
     ggcgaatctt cgacctcgtt tgcctcactc gaggctaccc ccactcctcg gcgtgcatgc       120
     cgcacatcgc tgctggcgcg gcgttatgcg cttgagctgc gccaggagac tccacggcgc       180
     aaacaggccg ttgtgcttgc cttttcagtc acggtgggac tggccgtctg tgttgcgatc       240
     ttgatgaccg cgggcatctc ggccagtgac ctgtttaatg aatttatcgt ggagacgtta       300
     ggcgacgccg acaactttcg ggctgtcctc tttcaggcgg cgccgatggt gatggtaggc       360
     cttgcggccg cgctgtcttt tcgggccaag ttctggaacc ttggtctgga aggccagatg       420
     gtgtggggcg ccattggcgc gaccgcggtt gcgctagcgg atgccggtac acccgagacg       480
     cgactgtggc tgatgggcgc cgcagcgctg gtttgcggtg cgctatggac tgtgttgccg       540
     ctgctgctca ggatgcgcct aggcatcagc gaaatcattt ccacactcat gcttaactac       600
     gttgcggcca accttctgtt gaatctggtc tatggccaat ggaaagaccc tagagattcg       660
     tttcctcatt cgcgcaactt cctggcagcg gagcgtcttc ccagcattgc cagcggatac       720
     agcagcgcaa tcttgctggc tgtgttgttc gcactagccg cctggtggtt cctgcatcgc       780
     agccgggctg gcatatacgt gcgattcgtg aacgtcaatg cgcgtgcggc ggaggcgatg       840
     ggcgtacccg tgcgcaacgt cgtagccggt gtcgtgctgc tctcgggtgc actcgcgggt       900
     tttgccggat ttacggtaac cgcggcgcag gctgggcggc tcacgcaaga tttctacagt       960
     ggctacggat tctcgggaat ccttatcgca ttcctcgcgc gcaacaaccc gatcgccgcc      1020
     agcgtggtcg cgctgctggt ggctgcgttg tttgtcaccg gccgcagcct gcaggtgttg      1080
     taccagatac cgttttcgat ggtgcaactc atccaggcga ttctcgtcat tgtcgttgcg      1140
     gcatcggact tcttcacccg ttaccgcctg tcgcccgtgg gagtagccga atga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page