(data stored in ACNUC7421 zone)

EMBL: CP001053.PE243

CP001053.PE243       Location/Qualifiers
FT   CDS_pept        283325..283900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4238"
FT                   /product="S-(hydroxymethyl)glutathione synthase"
FT                   /EC_number="4.4.1.22"
FT                   /note="KEGG: bam:Bamb_5797 glutathione-dependent
FT                   formaldehyde-activating enzyme; TIGRFAM:
FT                   S-(hydroxymethyl)glutathione synthase; PFAM:
FT                   glutathione-dependent formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18618"
FT                   /db_xref="GOA:B2TEU3"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEU3"
FT                   /protein_id="ACD18618.1"
FT                   /translation="MTRAIHLSVDHGIQKGASDFGGGTLRCSCTNDPVEVHVDTQVLYN
FT                   HACGCTQCWKPEHTLSSVVGVVPREKVAVTSHREKLKVRDDTALIQRDARTACGTHLYG
FT                   RIENKERAFYGLDFIQTELSTEAGWDGPGFAPFVSSIIESGTAPSSMVEVRQTPREKGL
FT                   EPYDCLSPALMDILAAHSAKAKSTHSEA"
     atgaccagag caattcatct ctccgtcgac cacggcatcc aaaaaggcgc aagtgacttc        60
     ggcggaggca ctttacgctg ttcgtgcacc aatgatccgg tagaggtgca cgtcgacacc       120
     caggtgttgt acaaccacgc gtgtggttgt actcaatgct ggaaacccga gcacaccctg       180
     tcctcggtcg tgggtgtagt tccgcgcgag aaggtggcag ttacgtcgca tcgcgaaaaa       240
     ctgaaggtga gggacgatac ggcactgatt cagcgcgacg cccgcactgc ctgcggcacc       300
     catctgtacg gacgtattga aaacaaggag cgcgctttct acgggctgga cttcattcag       360
     actgaactgt cgacggaggc tggctgggat ggtcctggct tcgcgccttt cgtctcgtcc       420
     attatcgaaa gtggcaccgc gccttcctcc atggtcgaag ttcgtcagac gccacgcgag       480
     aaggggctgg aaccctacga ttgtctaagt cccgccctga tggatatcct ggctgctcat       540
     tcggccaagg ccaagagcac ccacagcgag gcttga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page