(data stored in ACNUC7421 zone)

EMBL: CP001053.PE246

CP001053.PE246       Location/Qualifiers
FT   CDS_pept        287713..288102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4242"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: psa:PST_3582 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18621"
FT                   /db_xref="GOA:B2TEV0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="PDB:2RBB"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV0"
FT                   /protein_id="ACD18621.1"
FT                   /translation="MADLSYVNIFTRDIVALSAFYQQVFGFQEIESIRSPIFRGLDTGK
FT                   SCIGFNAHEAYELLQLAQFSETSGIKFLLNFDVDTKEAVDKLVPVAIAAGATLIKAPYE
FT                   TYYHWYQAVLLDPERNVFRINNVLL"
     atggcagatc tgtcttacgt caacatcttc acccgcgata tcgtggcgct cagcgctttc        60
     taccagcagg tgttcggctt ccaggaaatc gaatcgattc ggtcgccaat cttccgcggg       120
     ctcgacaccg gaaagagctg cattggcttc aatgcgcatg aggcatacga attactgcaa       180
     ctcgcgcagt tcagtgaaac cagcggtatc aagtttctgc ttaacttcga cgtcgatacg       240
     aaagaggccg tggacaagct ggtgcccgtg gcgatcgcgg ctggcgccac gctgatcaaa       300
     gcgccatatg aaacctacta tcactggtat caggcggttc tgctcgaccc ggaacgtaac       360
     gtattccgaa tcaataatgt cctgctctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page