(data stored in ACNUC7421 zone)

EMBL: CP001053.PE249

CP001053.PE249       Location/Qualifiers
FT   CDS_pept        290385..291500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4245"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mms:mma_2504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18624"
FT                   /db_xref="GOA:B2TEV3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV3"
FT                   /protein_id="ACD18624.1"
FT                   /translation="MTVGNVKEVPVLTRENELDVEGEARVYRSLRHFWHVVAYSHEVTD
FT                   KPVGFTLLEKDIVIVRLNGEISVFDDICPHRGTRLSLGHVRDGCRLECPYHGWQFDQEG
FT                   ELTLAPQRPDLAGQLRARTRKYLSVEKYGMVWACLEDKPHFPLPDYPVWDNPEFHYVAV
FT                   SPAEDWDCSAPRRVENYTDYSHFAILHDGFLADRTVPQVPPHDVFRNGNKLENVQGEGA
FT                   WVRVPIDSAAWGGKDKPADPYLRMYFKWRVFMPLTCVYDISFQDGNRYHLLFHPTPMGP
FT                   RKTRNFTVSHRDFGDKAKANEELGDFVKLIYDQDRWVVESQRPEELPEDLTKEMHVKGV
FT                   DKYSVEYRMWLLELARELTKPVIHLHQESVK"
     gtgactgttg ggaacgtaaa agaagtcccg gttctgaccc gggaaaacga attagacgtc        60
     gagggtgagg cgagggtata tcgttcgctt cgccacttct ggcatgtcgt cgcttactcg       120
     cacgaggtca ccgacaagcc tgtcggtttt accctgctgg agaaggacat cgtgatcgtg       180
     cggctcaacg gcgaaatctc ggtattcgac gatatttgtc cgcaccgcgg cacgcggctt       240
     tctctcggac atgtccgtga tggctgccgt ctggagtgcc cgtaccacgg gtggcaattc       300
     gaccaggagg gcgagctgac gctcgcgccg cagcgtcccg accttgccgg gcagctgcgc       360
     gcccgaaccc gcaagtacct atcggtcgag aagtacggca tggtatgggc ttgcctggag       420
     gacaagccgc atttcccgct gccggactat ccggtctggg ataaccccga gtttcactac       480
     gtggccgtct cgccggcgga agattgggac tgcagcgccc ctcgccgtgt cgagaactac       540
     accgactact cgcacttcgc gatccttcac gatggctttc tcgcggaccg taccgttccg       600
     caggtgccgc cgcacgacgt attccgcaac ggcaacaagc tcgagaacgt ccagggagaa       660
     ggcgcgtggg tgcgggtgcc gatcgactcg gcagcatggg gcgggaaaga caagccggcc       720
     gatccgtatc tgcgcatgta cttcaaatgg cgtgtgttca tgccgctaac ctgcgtgtac       780
     gacatctcgt tccaggacgg gaacagatac cacctgctgt tccacccgac gccaatgggc       840
     cccaggaaga cccgcaactt cactgtctcg caccgtgatt tcggcgacaa ggccaaggcg       900
     aatgaagaac tcggtgactt cgtcaagctt atctacgacc aggacagatg ggttgttgag       960
     tcgcagcgtc cggaggaact gccggaagac ctgaccaagg agatgcacgt caagggcgtc      1020
     gacaagtatt cggtcgaata ccgcatgtgg ctgctcgaac tcgcgagaga actgaccaag      1080
     ccggtgatcc acctccatca ggagagcgtc aaatga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page