(data stored in ACNUC7421 zone)

EMBL: CP001053.PE255

CP001053.PE255       Location/Qualifiers
FT   CDS_pept        297675..298835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4251"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cps:CPS_4049 FO synthase subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18630"
FT                   /db_xref="GOA:B2TEV9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEV9"
FT                   /protein_id="ACD18630.1"
FT                   /translation="MLSRAEAIALDQVSAGELHQLMRRACRVREKAWGATVTYSRKVFI
FT                   PLTNLCRDKCGYCTFARQPDEPGAGYLAPDQVMAIARRGEALGCKEALFSLGEKPELVY
FT                   PQARAVLDALGYATTMDYVIAMSERILAETSLIPHVNAGTLTRAEIVRLKAVCGSVGLM
FT                   LENVSRRLVQRGMAHYACPDKVPVQRLRTLDMAGVERIATTTGILIGIGETWVERIDSL
FT                   LAIAELHTRHGHIQEVIVQNFRAKPGTMMATWNEPGHEDMLRTLAVARLLLPTDISLQA
FT                   PPNLAEAFEDYLDSGINDWGGISPVTADYINPERAWPAIHDVARRSHGRGLGLAERLTV
FT                   YPRYLCQPDFVGAAPARALGCQARPDGLALHQYEAMPMAASAECAA"
     atgctttcca gagccgaggc aattgcgtta gaccaggtga gcgcgggcga actgcaccag        60
     ctaatgcgca gggcgtgccg tgtgcgcgag aaagcgtggg gcgcaacggt aacctattcc       120
     cgcaaggtgt tcattccgct gaccaacctg tgccgggaca agtgcgggta ctgcacgttc       180
     gcgcgccagc ctgacgaacc tggcgcaggc tacttggctc cggatcaggt catggcgatt       240
     gcgcgccgag gcgaggctct cggatgcaag gaggcgcttt tctcgctcgg cgagaagccc       300
     gagctggtat atccgcaggc ccgcgcggtg ctcgatgcgc tcggctacgc caccaccatg       360
     gactatgtca ttgcgatgag cgagcggatt ttggcggaga cctcgctgat tccgcacgtc       420
     aacgccggca cgctgacgcg tgccgagatc gtcaggctca aggcggtgtg cggcagtgtc       480
     ggtctgatgc tggaaaacgt tagccgccgg ctggtgcagc ggggcatggc gcactacgcc       540
     tgtcccgaca aggtgccggt gcagcgtctg cgcacgctcg acatggctgg tgtggagcgg       600
     atcgcgacca ccaccgggat tctgatcggc atcggtgaaa catgggtcga acggatcgat       660
     agcctgctcg cgattgccga actgcatacg cgccacgggc atatccagga agtcatcgtg       720
     cagaactttc gcgccaagcc aggcacgatg atggcgacat ggaatgagcc cggccacgaa       780
     gatatgctgc gcacgctggc cgtggcgcgg ctgctcctgc cgactgatat ctctctgcag       840
     gctccgccca acctggccga agccttcgag gactatcttg attccggcat taatgactgg       900
     gggggcatct cgccggtgac ggccgattac atcaaccccg agcgtgcctg gccggccatc       960
     catgatgtcg cgcgccgcag ccacggccgc ggtctcgggc tcgccgagcg gctgacggtc      1020
     tatccgcgct atctgtgcca gccggacttc gtcggggccg cgcccgcgcg ggcactgggt      1080
     tgccaggcgc gccccgacgg gcttgcactg catcagtacg aagccatgcc aatggcggct      1140
     tccgcggagt gcgcggcatg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page