(data stored in ACNUC7421 zone)

EMBL: CP001053.PE257

CP001053.PE257       Location/Qualifiers
FT   CDS_pept        300132..301136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4253"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: rxy:Rxyl_0958 LPPG:Fo 2-phospho-L-lactate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18632"
FT                   /db_xref="GOA:B2TEW1"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW1"
FT                   /protein_id="ACD18632.1"
FT                   /translation="MRDTGYPARIVLLAGGVGGARMALGLSAELATGSLSIVANIGDDE
FT                   DFYGLRVCPDLDTLLYTLSGKVDPMQGWGVEGDNTRALGVLGELGAPVWMKLGDADMGL
FT                   HVWRTWRLAFGESLTSVMAEASARFGVPGYLLPACDAPVPTEIVCDEGPLRFQQWFVAH
FT                   RAAPPVREVRYCGAEDRCATPEVLRAIEQADLIVIAPSNPLLSIEPMLALGGLREALQT
FT                   SGAPCVAVSPLIGGKAVKGPLDRMLDDMGLPGGNAGIAKRYEGLLHGLVIHTDDAADSA
FT                   GLQARGLAVLSAETRISSCPASVRLARTLLAWVRDGLPARQSIHGEMQKEVTI"
     atgcgtgaca ccggctatcc cgctcgcatc gtactgctgg ccggtggcgt gggcggcgcc        60
     cgcatggccc tcgggctgag cgccgaactt gcaaccggca gcctgagcat cgtcgccaat       120
     atcggcgacg acgaggattt ctacgggctg cgtgtctgtc cggacctcga caccctgctc       180
     tatacgctga gcggcaaggt cgatccgatg cagggctggg gcgtggaggg cgacaacacc       240
     cgcgccctcg gtgtgctcgg tgaacttggc gcgccggtgt ggatgaagct gggcgacgca       300
     gatatgggcc tgcatgtctg gcgcacatgg cgactcgcgt tcggcgagag cctgacgagt       360
     gtgatggccg aggctagtgc ccgcttcggc gtgccgggct atctattgcc ggcctgtgac       420
     gctcctgtac cgacggaaat cgtctgcgat gagggcccgc tgcgcttcca gcaatggttc       480
     gtcgcccacc gcgctgcgcc gcccgtgcgc gaggtgcgtt actgcggtgc ggaggaccgc       540
     tgcgcaacac ccgaggtcct gcgcgcgatt gagcaggcgg acctcatcgt gatcgcccct       600
     tccaatccgc tgctgtcgat cgaaccgatg ctcgcactcg gcggcttgcg cgaggccctg       660
     cagacctcgg gggcgccctg cgtcgccgtg tcgccgttga tcggtggcaa ggccgtgaag       720
     gggccgctgg accggatgct ggatgacatg ggcctgccgg gcggcaacgc cggcatcgcg       780
     aagcgctatg agggtttgct ccacgggctg gtgatccata ccgacgacgc ggccgatagc       840
     gcaggcttgc aggcgcgggg actggcggtg ctcagcgccg aaacccggat ttcgtcttgt       900
     ccggcttcag tccggcttgc ccgcaccctg ttggcatggg tgcgcgatgg ccttcccgcg       960
     cgccagagca tccatgggga gatgcaaaag gaggtcacga tatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page