(data stored in ACNUC7421 zone)

EMBL: CP001053.PE259

CP001053.PE259       Location/Qualifiers
FT   CDS_pept        301771..302550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4255"
FT                   /product="F420-dependent oxidoreductase"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase; PFAM:
FT                   protein of unknown function DUF129; KEGG: cps:CPS_4045
FT                   putative F420-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18634"
FT                   /db_xref="GOA:B2TEW3"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW3"
FT                   /protein_id="ACD18634.1"
FT                   /translation="MNAGSNTMELVALPGIPGVREGDDVGDLVADAMARTGRQWQTGDI
FT                   VVIAQKIVSKAEGRTRRLADIYPSHMAWEYASVSDKDPRKVQAMLDESVDVVRVAKVGP
FT                   DGLMITRHRHGWVCANAAIDESNVGEDGTMLLLPVDPDASAAEVARKLEARGGIKAGVI
FT                   ISDTFGRAWRRGLVNVAIGAANVPVIVDWIGRVDAYGRPLQISQPAFADEVAAAAGLLM
FT                   GKDSFTPVVLVRGLSWDIDNGAHARQLVRPLEEDLFQ"
     atgaacgcgg gaagcaacac catggaactg gtcgccttac ctggcattcc gggagtgcgc        60
     gaaggggacg acgtgggtga cctggtcgcc gacgcgatgg cgcgcaccgg acgccaatgg       120
     cagaccggcg acatcgtcgt gatcgctcag aagatcgtgt ccaaagcgga aggccgcacc       180
     cggcgcctcg ccgatatcta cccatcccac atggcgtggg agtacgcgag cgttagcgac       240
     aaggatcccc gcaaggttca ggccatgctt gacgagtctg tggacgtggt gcgggtggca       300
     aaggtggggc cggacggcct gatgatcacg cgccaccggc atggctgggt ctgcgccaac       360
     gccgccatcg acgaaagcaa tgtcggtgaa gacggcacga tgctgctgct gccggtcgac       420
     cccgacgcca gcgcggccga ggtggcgcgc aagctggagg cgcgcggcgg catcaaggct       480
     ggcgtgatca tcagcgacac ctttgggcgc gcgtggcggc gcgggctggt caacgtggcc       540
     atcggcgcgg ccaacgtgcc ggtgatcgtc gactggatcg gccgggtgga tgcctatggc       600
     cgtccgctgc agatttcaca gccggcgttc gccgatgagg tagcggcggc agccggactg       660
     ctgatgggga aggacagctt cacgcctgtg gtgctcgtgc gcgggctgag ctgggacatc       720
     gacaacggcg ctcatgccag gcagctggtg cgccctttgg aggaggactt gttccaatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page