(data stored in ACNUC7421 zone)

EMBL: CP001053.PE265

CP001053.PE265       Location/Qualifiers
FT   CDS_pept        307193..308656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4261"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   reh:H16_A3131 NAD(P) transhydrogenase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18640"
FT                   /db_xref="GOA:B2TEW9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEW9"
FT                   /protein_id="ACD18640.1"
FT                   /translation="MNGLSMNSVTLLYLGASVCFIQALKGLSHPTTARRGNVFGMSGMA
FT                   IAAVTTLLLIVKLKNEFLAAGTAQSPVGLGLILIFGALVVGGGIGAYAAKQVEMTRMPE
FT                   LVAAMHSLIGLAAAFIAVAAVAEPAAFGITQAASHEIPLGNRIELFIGCFVGAITFSGS
FT                   VIAFGKLAGRFKFRLFQGAPVVFAGQHWLNLLLAVAMISFGCLFAQSQDWLPFLLMLAI
FT                   AFVLGVLIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNQPMLIVAGSLVGSSGAILS
FT                   YIMCRAMNRSFFRVLLGGFGGATAAAADQLQRPVKAGSADDAAFLLGNAETVVIVPGYG
FT                   LAVARAQHALKELTEMLKGKGVSVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDI
FT                   NSEFGQADVVLVLGANDVVNPSAKTDPNSPIAGMPILEAYKAKTIIVNKRSMAAGYAGL
FT                   DNELFYMDKTMMVFGDAKKVVEDMVKAVH"
     atgaacggac tctcgatgaa ttcggtcacc ctgctttatt tgggggcttc ggtctgcttc        60
     atccaggcgc tcaagggtct gtcgcacccg actacggctc gcagaggcaa cgtcttcggc       120
     atgagcggca tggccatcgc cgcggtgacc acgctgctgc tgatcgtcaa gctcaagaat       180
     gagttcctgg cggcgggcac ggcgcagtcg ccggtgggct tgggcctgat tctgatcttt       240
     ggtgcgctgg tggtgggtgg cggcatcggc gcctacgcgg cgaagcaggt cgagatgacc       300
     aggatgccgg agctggtcgc ggcgatgcac tcgctgatcg gtctggccgc cgcgttcatc       360
     gcggtcgcgg cggtcgccga gccggcggca ttcggcatca cgcaggcggc ctcgcatgaa       420
     atcccactgg gcaatcgcat cgaactgttc attggctgct ttgtcggcgc gattaccttc       480
     tctggttccg taatcgcctt tggcaagttg gccggacgct tcaagttccg cctgttccag       540
     ggcgcaccag tggtgtttgc cggccagcac tggctgaacc tgctgctggc ggtggcgatg       600
     atcagtttcg gatgcctctt cgcccagtcg caggattggc tgccgtttct gctgatgctg       660
     gcgattgcct ttgtgttggg tgtgctgatc attattccga tcggcggtgc agacatgccg       720
     gtggtggtgt cgatgctgaa ctcgtactcg ggttgggcgg cggcaggcat cggcttctcg       780
     ttgaaccagc cgatgctgat cgttgccggc tcgctggtgg gatcaagcgg tgcgatcctg       840
     tcgtacatca tgtgccgtgc gatgaaccgg tcgttcttcc gcgtgctgtt gggcggcttc       900
     ggcggcgcga ccgcggcggc ggccgaccag ctacagcgcc cggtcaaggc gggctcggct       960
     gatgatgcgg ccttcctgtt aggcaacgcg gaaaccgtgg tcatcgtacc tggatacggc      1020
     ttggcggtgg cccgcgcgca acatgcgctc aaggaactca ccgagatgtt gaagggaaag      1080
     ggcgtgagcg tgaagtacgc gatccacccg gtggcgggcc gcatgccggg ccatatgaac      1140
     gtgctgctgg ccgaggctga ggtgccgtac gatcaggtct tcgagatgga agacatcaac      1200
     agcgagttcg gccaagcaga cgtcgtgctt gtgctcggcg ccaatgacgt ggttaacccg      1260
     tcggccaaga ccgatcccaa ttcgcccatt gccggcatgc cgatcctcga ggcctacaag      1320
     gccaagacca tcatcgtgaa caagcgctcg atggctgccg gctacgccgg gctggacaac      1380
     gaactcttct acatggacaa gaccatgatg gtattcggcg atgccaagaa ggttgtggaa      1440
     gacatggtga aggctgtgca ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page